KEGG   Meleagris gallopavo (turkey): 100546927Help
Entry
100546927         CDS       T01523                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04110  Cell cycle
mgp04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100546927 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100546927 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100546927 (HDAC1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100546927 (HDAC1)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100546927 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100546927 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100546927 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100546927 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100546927
NCBI-ProteinID: XP_010721789
Ensembl: ENSMGAG00000004647
LinkDB All DBs
Position
25
AA seq 488 aa AA seqDB search
MWFEWLHLKQFMFFPAVTKSFLSPGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME
IYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQL
SAGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLY
IDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGI
DDESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFN
LPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTN
QNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPEDAVQEDSGDEEEEDPEKRISIRNSDK
RISCDEEFSDSEDEGEGGRKNVANFKKAKRAKTEEEKEEEEKKDEKEEEKAKEEKAEPKG
VKEETKST
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttgagtggttgcatttgaagcagttcatgtttttccctgctgtaacaaaatcc
tttctgtccccaggtgatgttggaaactattattatggccagggacaccccatgaagccc
cacaggatccggatgacccacaacctactgctgaactacggcctttacaggaagatggag
atatatcgccctcacaaggcgaacgcggaggagatgaccaagtaccacagcgacgactac
atcaaattcctgagatccatccgcccagacaacatgtctgagtacagcaagcagatgcag
agatttaacgtcggggaggactgccctgtgttcgatgggctgtttgagttctgtcagctc
tctgctggaggctcagttgccagcgctgtgaagctgaacaagcagcagacagatattgct
gtgaattgggcaggaggcctccaccacgctaaaaagtcggaggcttctggcttctgttat
gtcaacgacattgtcctggctatcttggagctcttaaagtatcaccagagggtcctgtat
atcgacattgatattcaccatggagatggtgtggaggaagccttctataccacagaccgt
gtgatgaccgtgtcctttcataagtatggagagtacttcccaggaacaggggacctgcgg
gacattggtgcaggcaaaggcaagtactatgctgtcaactatcccctccgggatgggatt
gatgatgagtcctatgaggcaatattcaagccggtgatatctaaagtgatggagacattc
cagcctagtgcagttgtcctgcagtgtgggtcagattctctgtccggagacaggctgggt
tgttttaatctgaccatcaaaggtcatgccaagtgtgtggagtttgtcaaaagttttaat
ttgcccatgctgatgctgggaggaggtggctacacgatccgcaacgtggccagatgctgg
acctacgagactgctgtggctttggacactgagatcccaaatgaactcccatataatgac
tattttgagtacttcggaccagactttaagctgcacatcagtccctcaaacatgactaac
cagaataccaacgagtatctcgagaagatcaagcagcgtctctttgagaatctgcgcatg
ctgcctcatgcccctggcgtccagatgcagccaattcctgaggatgctgttcaggaagac
agtggagatgaagaggaagaagatcctgagaagcgcatttcaatccgcaattctgataag
agaatatcctgcgatgaggaattctctgactctgaagatgaaggggaaggagggcgcaaa
aatgttgctaactttaagaaggccaagcgtgcgaaaacagaagaggaaaaagaggaggag
gagaagaaggacgagaaagaagaagaaaaagcaaaagaggagaaagccgaacccaagggg
gtgaaggaagagacaaaatccacctaa

DBGET integrated database retrieval system