KEGG   Meleagris gallopavo (turkey): 100547023
Entry
100547023         CDS       T01523                                 

Gene name
ZMAT3
Definition
(RefSeq) zinc finger matrin-type protein 3
  KO
K10137  zinc finger, matrin type 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100547023 (ZMAT3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 100547023
NCBI-ProteinID: XP_003209243
Ensembl: ENSMGAG00000009873
UniProt: G1NC10
LinkDB
Position
11
AA seq 289 aa
MILLQQAGLLPHPEKPSSLPMSVATRPRATSPLSPPKSLGLGPSFYHAQDEELAKVVEQD
PMLEELCKPLCCKLCNVTLNSAQQAQAHYQGKNHSKKLRNYYAANSCPAPARMSNSVEPV
PPQVVSLPAQMGSSKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QNNSFSDASELGKRRTRKEGNEYKMMQNRRNMYTVQNNTGPYFNPRSRQRIPRDLAMCVT
PSGQFYCSMCNAGASEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYVQ
NT seq 870 nt   +upstreamnt  +downstreamnt
atgattcttctacagcaagcaggacttcttcctcatcctgagaaaccttcatctcttcct
atgtcagtggctacaaggcccagagccacctcaccactctccccaccaaaatcacttgga
ctggggccttccttttatcacgcacaagacgaagagcttgcaaaggtggtggagcaggac
cctatgctggaggaactatgtaagcctctttgttgtaagctctgcaatgtcactctgaat
tcagctcagcaagcccaggctcattaccagggtaaaaaccacagtaagaaactccgaaat
tactatgctgccaatagctgcccggcacccgccaggatgagtaattcagttgagcctgtg
ccacctcaggttgtttcccttccagctcagatgggatccagtaaaccaggcggtcgagtg
atcttggccacagagaatgattactgcaagctttgtgatgcctcatttagttctccagct
gtggcacaggctcactaccaggggaaaaatcatgccaaacggctgcgtcttgcagaagca
cagaataactcattctcggatgcatcagaactaggcaaacggaggacaaggaaagaaggg
aatgaatataaaatgatgcagaacagaagaaatatgtacacagttcaaaacaacacaggt
ccctacttcaatccccgctctcgtcagaggattcctcgggatctggcaatgtgtgtcacc
cccagtggccagttctactgctccatgtgcaacgctggggccagtgaggagatggagttc
aggcagcacttagaaagcaaacagcataaaagcaaggtgtctgaacagcggtacagaaat
gagatggagaacttaggctacgtacaatga

DBGET integrated database retrieval system