KEGG   Meleagris gallopavo (turkey): 100547142
Entry
100547142         CDS       T01523                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04068  FoxO signaling pathway
mgp04217  Necroptosis
mgp04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100547142 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100547142 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100547142 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mgp03000]
    100547142 (STAT3)
Transcription factors [BR:mgp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100547142 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N Fib_alpha Tropomyosin_1
Other DBs
NCBI-GeneID: 100547142
NCBI-ProteinID: XP_003213184
Ensembl: ENSMGAG00000003545
LinkDB
Position
29
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGSAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGNSSEGAEANAGGQFESLTFDMELTQECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccaactgcagcagctcgacacgcgctacctggagcagctccaccag
ctttacagcgacagcttccccatggagctgcggcagttcctggccccgtggattgagagc
caggactgggcgtacgctgctaacaaggagtcgcacgccacgctggtgttccacaacctg
ctgggggagatcgaccagcagtacagccgcttcctgcaggagtccaacgtcttgtaccag
cacaacctgcggcgcatcaagcagttcctgcagagcagatacttggagaagccgatggaa
atagcccgcatcgtggctcgctgcctgtgggaagagtcacggctcctccagacagctgcc
accgcagcccagcaagggggacaggcgacacatccaacagcagctgtagtgacagaaaag
cagcagatgctggagcagcatctgcaggatgtaaggaagagagtgcaggatctggagcag
aagatgaaagtggtggaaaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggatctgaatggaaacaatcagtcggtgacgcgtcagaaaatg
cagcagctggaacagatgctcacagcgttggaccagatgcgaaggggtattgtgagtgag
ctggcaggactgctgtcagccatggagtatgtgcagaagatgctggcagatgaggagctg
gcagactggaagagacggcaacaaattgcctgcattggtggcccaccaaatatctgctta
gaccggcttgagaactggataacctctcttgctgaatcacagctacagacccggcaacag
atcaagaaactggaagagctgcagcagaaggtgtcctacaagggtgacccaattgtccaa
caccggccaatgctggaggagcggatcgtggagctgttcaggaacctgatgaagagtgct
tttgtggtggagaggcagccctgcatgcccatgcatcctgaccggcctctggtcatcaaa
accggtgtgcagttcaccaccaaagtcagattgttggtgaagtttccagagttgaactat
cagctgaaaatcaaagtctgcattgacaaggactctggtgatgttgcagctcttcggggg
tcccggaagttcaacatcctggggacgaacaccaaggtcatgaacatggaggagtcaaat
aacggcagcctttcagcagagttcaagcacctgacactgcgggaacagcggtgcggtaat
ggaggcagagccaactgcgatgcctcgctgattgtgactgaggagctgcatctcatcacc
tttgagactgaggtgtaccaccaggggctgaagatcgatctggagacccactcactgcct
gtggtggtcatctcaaatatctgccagatgcccaatgcctgggcatccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccacccattggcacg
tgggaccaggtggcagaggtgctgagctggcagttctcctctaccacaaagcgtggtctc
agcatcgagcagctgacaaccctggcagaaaaacttctagggccaggtgtgaactactct
ggctgtcagatcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctcc
ttctgggtctggctagacaacatcattgacttggtgaagaaatatatcctggcgctgtgg
aatgaagggtacatcatggggttcatcagcaaggagcgggagcgagccatcctgagcacc
aagcctccaggaaccttcctgctgcgcttcagcgagagcagcaaggagggtggcatcacc
ttcacgtgggtggagaaggacatcagtggaaagactcagatccagtctgtggaaccttac
accaaacagcagctgaacagcatgtcatttgcggaaatcatcatgggctacaaaatcatg
gatgccaccaacattctggtgtctcccctggtgtacctgtacccggacatcccaaaagag
gaggcgtttgggaagtactgccgctctgagagccaggaacactcagaagctactgactca
ggtagtgctgctccgtatctgaagacaaagttcatctgtgtcacccccacctccttcagc
aataccattgacctgcccatgtccccgcgcaccctggactcactcatgcagtttggcaac
agtagcgagggagcagaggccaacgcaggagggcagtttgagtcgctgaccttcgacatg
gagctgacccaggagtgtgcttcttcaccgatgtga

DBGET integrated database retrieval system