KEGG   Meleagris gallopavo (turkey): 100547152Help
Entry
100547152         CDS       T01523                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00480  Glutathione metabolism
mgp00980  Metabolism of xenobiotics by cytochrome P450
mgp00982  Drug metabolism - cytochrome P450
mgp00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100547152 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100547152 (MGST1)
   00982 Drug metabolism - cytochrome P450
    100547152 (MGST1)
   00983 Drug metabolism - other enzymes
    100547152 (MGST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mgp02000]
    100547152 (MGST1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100547152 (MGST1)
Transporters [BR:mgp02000]
 Other Transporters
  Pores ion channels [TC:1]
   100547152 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG Anoctamin
Motif
Other DBs
NCBI-GeneID: 100547152
NCBI-ProteinID: XP_003202527
Ensembl: ENSMGAG00000013573
UniProt: G1NLF4
LinkDB All DBs
Position
1
AA seq 155 aa AA seqDB search
MAKSTQLIDNEVFRAYATYAAIVLVKMMLMSLVTAYFRITRKAFANPEDTASFGKGDSAK
KFLRTDADVERVRRGHLNDLENIVPFFGIGLLYALCGPDLSTALLHFRIFAGARIFHTFA
YLIPLPQPSRGLSWAVGYAVTISMAYKVLSKALYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatcgacccagctaattgacaatgaagtcttccgtgcttacgctacttatgca
gctattgttcttgtaaaaatgatgcttatgagccttgtaactgcatacttcagaatcaca
agaaaggcatttgccaacccagaagatacagcatcatttggtaaaggtgatagtgctaaa
aaattcctgcggactgatgcagatgttgaacgtgtacgcagaggccacctgaatgacctt
gaaaacattgtcccattttttggcattggattgctgtatgctctttgtggccctgatcta
tccacggccttgctgcattttaggatcttcgcaggggcaaggatctttcacactttcgca
tacttgatccctcttccccagcccagcagaggtttgtcttgggcagttgggtatgcagtt
accatctcaatggcatacaaagtgctgagtaaagcactgtacctgtag

DBGET integrated database retrieval system