KEGG   Meleagris gallopavo (turkey): 100547459
Entry
100547459         CDS       T01523                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04020  Calcium signaling pathway
mgp04260  Cardiac muscle contraction
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04270  Vascular smooth muscle contraction
mgp04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100547459
   04020 Calcium signaling pathway
    100547459
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100547459
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100547459
   04261 Adrenergic signaling in cardiomyocytes
    100547459
   04270 Vascular smooth muscle contraction
    100547459
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mgp04040]
    100547459
Ion channels [BR:mgp04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100547459
SSDB
Motif
Pfam: Ion_trans PKD_channel DUF4834 Rer1
Other DBs
NCBI-GeneID: 100547459
NCBI-ProteinID: XP_031410951
LinkDB
Position
1
AA seq 1037 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHG
RQCQNGTECKAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGRDWPWI
YFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQ
AEDIDPENEDEGMDEEKPRNRSTPAGLPDKKKEKFSWFSHSTETHVSMPTSETESVNTDN
VPGTDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNT
LTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCG
GILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLL
FLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMA
YGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKL
ARTASPEKKQEIEKTAVEEETKEEKIELKSITADGESPPATKINMDDYQPNENEEKSPYP
TTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAVPMPDASAFFIFSPNNRFRVHCHRIVN
DNIFTNLILFFILLSSISLAAEDPVRHLSFRNQVLFYFDIVFTVIFTIEIALKMTAYGAF
LHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHV
VQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTEAECRGYYITYKD
GEVSQPMIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNH
RVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARP
LRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQVSKQVENLTGDELLDFVGE
NLEITETETYFCFHIMS
NT seq 3114 nt   +upstreamnt  +downstreamnt
atggtccctttgttgcatattgccctgctggtgctgtttgtcatcattatctatgccatc
attggactggaattattcatgggaaagatgcataagacctgctaccacgtgcaagggggg
ctgatagatacacctgcagaagatgacccatctccctgtgccccccagtctgcacatggg
cggcagtgccagaatggaaccgagtgcaaggcaggctgggagggacccaagcacggcatt
acaaactttgacaattttgcttttgccatgctgacagtgtttcagtgcatcacaatggag
gggtggacagatgtactctactgggtcaatgatgccataggaagggactggccctggatc
tattttgttacactaatcatcatagggtcattttttgtacttaacttggttctcggtgta
cttagcggggaattttccaaggaaagagagaaggctaaggctcggggagatttccaaaag
ttacgggaaaagcaacagctagaggaggatttgaagggctatttagactggataactcaa
gcagaagatattgacccagaaaatgaagatgaaggcatggatgaggagaagcctcgaaac
agaagcactccagctggcttgcctgataagaagaaagaaaagttttcttggtttagtcac
tccacagaaacccatgtgagcatgcccaccagtgagaccgagtccgtgaacacagacaac
gtccctggaacagatattgaaggcgaaaactgcggtgctaggctagcgcatcggatctcc
aaatctaaatttagtcgctattggcgccgatggaatcgattctgcagacgaaagtgccgt
gctgctgtcaagtccaatgttttctactggttggtgatcttccttgtgtttctcaacacc
cttaccattgcttctgaacactataaccagccagactggctcactgaggttcaagacact
gccaataaggtgctgctagctcttttcactgctgagatgctgctgaagatgtacagcctt
ggtctccaggcctattttgtgtccctcttcaaccgctttgactgtttcattgtgtgtgga
ggaatcctggaaacaattctggttgagacgaagattatgtcaccactgggcatttctgtg
ttgagatgtgttcggctattaagaatatttaaaatcacaagatattggaactccttgagt
aacctagtggcttcactcctgaattcagtccgttccattgcctccctcctgctgctcctc
ttcctcttcatcatcatcttctccctgctggggatgcagctttttgggggcaagtttaac
tttgatgaaatgcagaccaggaggagtacatttgacaacttcccccagtctctcctcact
gtgtttcagatcctgactggggaggactggaattcggtgatgtatgatgggatcatggct
tatggcggcccctcttttccaggaatgttggtctgtatttacttcatcatcctcttcatc
tgtgggaactacatcctgctgaatgtctttttggccattgctgtggacaaccttgctgat
gcggagagtttaacatctgcacagaaagaggaggaagaggaaaaagaaaggaaaaaatta
gctaggactgctagtcctgaaaagaaacaggagatagagaaaacagctgtggaggaggag
acaaaggaggagaaaattgagctgaaatcaatcactgctgatggagaatctccacctgct
accaagatcaacatggatgactatcagccaaatgaaaatgaagaaaagagcccatatccc
acaacagaagcaccagcagaagaagatgaggaagaacctgagatgcctgtcggccctcgg
cctcgcccaatgtctgagctgcacctcaaggaaaaggctgtgcccatgcctgatgccagc
gcttttttcatcttcagtcctaacaacaggtttcgtgtccactgccatcgaatcgttaac
gataacattttcaccaacctgatcctatttttcatcttgctcagcagcatctccttggca
gctgaggaccccgtccggcacctctcctttaggaaccaagttctcttttattttgatata
gtttttactgtcattttcaccattgaaattgctctgaagatgaccgcatacggggctttc
ctccataagggctccttctgcagaaactatttcaacatcttagacctgctggtggtcagc
gtttctctcatctcttttggaatccaatccagtgccatcaatgtggtgaagattttgcgt
gttctgcgagtgcttagaccactgagggccatcaacagagccaaaggactaaagcatgtg
gtccaatgtgtatttgttgccatccgaaccatcggaaacattgtgattgtcaccaccttg
ctgcagttcatgtttgcctgcattggagttcagttgtttaagggcaaactctacagctgc
actgacagctccaagcaaactgaagcagaatgcagaggatactacatcacatacaaggat
ggtgaggtcagtcagccaatgatccagccccggagctgggagaacagcaagtttgacttc
gacaatgtcttgactgccatgatggccctcttcactgtctcaacttttgagggctggcca
gagttgctgtataggtccattgattcccacatggaggatgtgggacccatctataatcac
agggttgagatctccatcttctttattatctacatcatcatcattgctttcttcatgatg
aacatcttcgttggtttcgtcatcgtcacatttcaggaacaaggagaacaagaatacaag
aactgtgagctggacaagaaccagcgccagtgcgtagagtatgccctgaaggcccggccc
ctgcggagatacatcccaaaaaaccagtaccagtacaaagtttggtatgtggtcaactcc
acctattttgagtacctgatgttcgttttgatcctgctgaacaccatctgtctggccatg
caagtaagtaagcaagtagaaaacctcacaggtgatgaattgttagactttgttggggaa
aatttagaaattacagagactgagacctacttttgctttcacatcatgagttga

DBGET integrated database retrieval system