KEGG   Meleagris gallopavo (turkey): 100547667
Entry
100547667         CDS       T01523                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00562  Inositol phosphate metabolism
mgp01100  Metabolic pathways
mgp04020  Calcium signaling pathway
mgp04070  Phosphatidylinositol signaling system
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04270  Vascular smooth muscle contraction
mgp04310  Wnt signaling pathway
mgp04371  Apelin signaling pathway
mgp04540  Gap junction
mgp04621  NOD-like receptor signaling pathway
mgp04912  GnRH signaling pathway
mgp04916  Melanogenesis
Module
mgp_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100547667
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100547667
   04371 Apelin signaling pathway
    100547667
   04020 Calcium signaling pathway
    100547667
   04070 Phosphatidylinositol signaling system
    100547667
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100547667
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100547667
  09152 Endocrine system
   04912 GnRH signaling pathway
    100547667
   04916 Melanogenesis
    100547667
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100547667
   04270 Vascular smooth muscle contraction
    100547667
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100547667
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100547667
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100547667
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100547667
SSDB
Motif
Pfam: PI-PLC-Y DUF1154 C2
Other DBs
NCBI-GeneID: 100547667
NCBI-ProteinID: XP_019468151
Ensembl: ENSMGAG00000006407
LinkDB
Position
2
AA seq 646 aa
MASYKYVGATTNIHPYLSTMVNYAQPVKFQGFDIAEERNIHHNMSSFNESVGLGYLKTHA
IEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYN
GSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYG
LPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNKLIGQRILP
LDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKR
ADQMRAMGIETSDIADVPNDTSKNDRKGKANNAKANVTPQSSSELRPSTTAGFGSGTDAK
KGIDLIPQVKIEDLKQMKAYIKHLKKQQKELNALKKKHAKEHSAMQKLHCTQIDKIVAQY
DKEKVSYEKMLEKAIKKKGGSNCVELKKETEIKIQALTSDHKSKVKEIVAQHTKEWSEMI
NTHSAEEQEIRDLHLNQQCELLKKLLINAHEQQTQQLKFSHDRESKEMRANQAKISMENS
KAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQLEHLEVLE
KQNEQLLKSCHAVSQTQGKGDAADGEAGSRDGSQASNSGLKPQHAN
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggcatcttataaatatgtaggtgccacaaccaacatacatccgtatttatcaacaatg
gtcaactatgctcagcctgtaaaatttcaaggtttcgacatagcagaagaacgtaatatt
catcataacatgtcttctttcaatgaatcagttggactagggtatttgaagactcatgcc
attgagtttgtgaattataataaacgacaaatgagtcggatatacccaaagggaggccga
gtggattccagtaattacatgcctcaaattttctggaacgctggctgccagatggtctca
ctgaactatcagaccccagatttagcaatgcagttgaatcaaggaaaatttgaatataat
ggatcatgtggctatctacttaaaccagatttcatgcgccgaccggatagaacatttgac
cctttctctgaaactcctgtagatggtgtaattgctgcaacgtgttctgtacaggtaata
tctggtcagtttttatcagataaaaagattggtacgtatgtagaagtggatatgtacggc
ttacccacggacacaatacgtaaagaatttagaacacgcatggtgatgaacaacggtctg
aaccctgtttacaatgaagaatcatttgtatttcgaaaggttattctccctgatcttgct
gtcctgagaatagcagtatatgatgacaataataagttgatcggtcagaggatcctgcct
ctagatggtctacaagcaggttacagacacatttcacttcgaaatgagggcaacaaacca
ctctctcttccgacggttttctgcaacattgtgcttaaaacatatgtgcctgatggtttt
ggagatattgtggatgctttgtcagatccaaagaaatttttgtctattacagaaaaaaga
gcagaccaaatgagagctatgggtattgaaactagtgatatagctgatgtaccaaatgac
acttcaaaaaatgatagaaaagggaaagctaataacgccaaagcaaacgtgactcctcag
agtagctctgagcttcgaccaagtaccacagcaggctttgggtctgggaccgatgctaag
aaaggtatagacctaattcctcaagtgaagatagaagatttaaagcaaatgaaggcttac
ataaaacatttaaagaaacagcagaaagagctgaatgccttaaagaagaagcatgcaaag
gagcacagcgctatgcagaagttgcactgcacacaaattgacaaaatagtggcacaatat
gataaagaaaaggtatcatacgagaaaatgttagagaaggcaatcaagaagaagggagga
agtaattgtgttgaattgaagaaagaaactgaaattaaaattcaggcactaacgtcagat
cacaagtctaaggtcaaagagattgtggcacagcacactaaagagtggtctgagatgatc
aatacgcatagtgcggaagagcaagaaatccgtgatttacacttgaaccaacagtgtgaa
ctactgaagaaactgctgattaatgctcatgaacaacagacccagcagctaaaattttca
catgacagggaaagcaaggagatgcgtgcaaaccaggcaaaaatatctatggagaacagc
aaagccataagccaagataaatctatcaaaaacaaagcagaaagagagaggcgagtcaga
gaattgaacagcagcaacacgaaaaaattcctggaagagagaaaaaggcttgcaatgaaa
cagtcaaaggaaatggatcagttgaaaaaagttcagcttgagcatttagaagtcttggaa
aagcagaatgagcagcttttgaaatcctgtcatgcagtgtctcaaacacaaggcaaagga
gatgcagcagatggtgaagctggaagcagagatggatcgcaggccagcaacagtggtcta
aagcctcaacatgcaaattga

KEGG   Meleagris gallopavo (turkey): 100548128
Entry
100548128         CDS       T01523                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1-like
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00562  Inositol phosphate metabolism
mgp01100  Metabolic pathways
mgp04020  Calcium signaling pathway
mgp04070  Phosphatidylinositol signaling system
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04270  Vascular smooth muscle contraction
mgp04310  Wnt signaling pathway
mgp04371  Apelin signaling pathway
mgp04540  Gap junction
mgp04621  NOD-like receptor signaling pathway
mgp04912  GnRH signaling pathway
mgp04916  Melanogenesis
Module
mgp_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100548128
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100548128
   04371 Apelin signaling pathway
    100548128
   04020 Calcium signaling pathway
    100548128
   04070 Phosphatidylinositol signaling system
    100548128
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100548128
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100548128
  09152 Endocrine system
   04912 GnRH signaling pathway
    100548128
   04916 Melanogenesis
    100548128
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100548128
   04270 Vascular smooth muscle contraction
    100548128
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100548128
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100548128
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100548128
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100548128
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y EF-hand_like PLC-beta_C DUF1154 C2
Other DBs
NCBI-GeneID: 100548128
NCBI-ProteinID: XP_031408537
Ensembl: ENSMGAG00000006484
LinkDB
Position
2
AA seq 1679 aa
MAKPYEFNWQKPVPSFMQDGAVFDRYEEESFVFESNCLFQVDEFGFFLSWKSEGKEGQVL
ECSLINSVRFGAVPKDPKILTALEAVGKSENELEGRIVCVCSGIDLVNISFTFMVAENTE
VAKQWVEGLGSIIHNFRANNVSPMTCLKKHWMKLAFLTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDXKRAMQIIETYEPDEDLKSKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQPLETHPLDPGKALPSPNDLKRKILIKNKRLKPEVEKKQLDALKKM
MEAGETAAPVNILEDDNEEEIESADQEEEAHPEYKFGSDLTVDDYSQKEAVAISVKKVGL
LLTYISLEAFHGCKTHSVLWKHHSTYCQKSPTQDLHQIPNIYYEVDIWDLLANGVSRKVV
PHDDELSQFSWRFCKLNSLEICKGKTKLQVELDQEYQDKFKRLPLEILEFVQEAMKGKIS
EDGDHSSAPSSLASDSGKSNHKPLQSEEELEEDNSEKVDHGDAPSEANSEPRPAPAENGV
NHTASLTPKPATQVVHSQPTPEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTT
DLIKEHTAKYNEIQNDYLRRRAVLEKTAKRDSKKRSETGSPDHGSSTIEQELAALDSEMT
QKLVELKEKQQQQLLNLRQEQYYSEKYQKREHIKLLEDAQSKRQEKLIEKHKEIRQQILD
EKPKVVLPTLACLRLAVYEEGGKFIGHRILPVSAIRPGYHYICLRNERNQPLTLPALFVY
IEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEDPKLRELLDAG
NVGSRLENRMITVVYGPDLVNISYLNLVAFQEDIAKEWSDEVFSLATNLLAQNMSRDAFL
EKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACNLPSSRNDSIPQDDFTPDVY
RVFLNNLCPRPEIDHIFSEFGAKSKPYLTVDQMMEFINLKQRDPRLNEILYPPLKQEQVQ
QLIEKYEPNSNLAKKGQISVDGFMRYLSGEENGVVPPEKLDLNEDMSQPLSHYFINSSHN
TYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVI
EAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMDPLEKYPLEPGVPL
PSPMDLMYKILVKNKKKSHKSADGSAKKKLSEQASNTCSDTSSMFEPSSPGAGEAEIESD
DDDDYDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEVSKKRNKSFEMSSFV
ETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQVFWNAGCQMVALNFQTVDL
SMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTESIVDGIVANTLSVKIISGQFLSDK
KVGTYVEVDMFGLPVDTRRKALKTKTSQGNAVNPVWEEETIVFKKVGVTLASQTSVECV
NT seq 5040 nt   +upstreamnt  +downstreamnt
atggcaaaaccttatgaatttaactggcagaagccggttccctcttttatgcaagatgga
gctgtgtttgatagatatgaagaggaatcttttgtctttgaaagcaattgtctctttcaa
gtggatgaatttggcttttttctgagctggaaaagtgaaggaaaggaaggacaggtgtta
gagtgttccctgatcaacagtgttcgttttggagctgttccaaaggatcccaaaatactg
actgcacttgaggctgttggaaaatcagaaaatgagttggaaggacggatagtgtgtgtt
tgcagtggtatagatctggtgaacatcagcttcactttcatggtagcagaaaacacagaa
gttgccaagcaatgggtagaaggactgggatccatcatacataactttagagctaacaat
gtcagtccaatgacatgtctcaagaaacactggatgaagctggcctttctaacaaataca
aatgggaaaattccagttcggagcattaccagaacctttgcatcaggtaaaacagaaaaa
gtgatctttcaagcactcaaggaattaggtcttcccagtggaaagaatgatgaaattgag
cctgcagcatttacttacgagaaattttatgagctcacccaaaagatatgtcccagaact
gacatagaggacctctttaagaagatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcggctcaatgaaattttattt
cccttttatgacnacaaaagagccatgcagataattgagacgtatgagccagatgaagac
ttgaagagtaaaggtctcatatcaagtgatggattttgcagatacttgatgtcagatgaa
aatgccccagttttcctagaccgtttggaattatatcaagaaatggaccatcctttggct
cactattttatcagttcctctcacaacacgtatttaacaggcaggcagtttggtggcaag
tcttcggtggagatgtacagacaagtgcttttggctggatgcaggtgtgttgagctggac
tgttgggacggaaaaggtgaagaccaagaaccaataataacacatggaaaagcaatgtgt
acagatattcttttcaaggatgtaattcaagccattaaggaaacagcttttgttacatca
gagtatcctgtcattctttcatttgaaaatcattgcagcaaatatcagcagtataagatg
tcaaaatactgtgaggatctttttggagatctcctgttgaagcagcctctagaaacacat
ccacttgatccaggtaaagccttaccttctcctaatgacctcaaaagaaagattctcata
aagaataaaaggttgaaacctgaagtagaaaaaaaacagctcgatgctctaaaaaagatg
atggaggctggtgaaactgctgctcctgtgaatatcttagaggatgataatgaagaagaa
atagaaagtgctgaccaggaagaagaagctcatccagaatataaatttgggagtgacctt
actgtagatgattacagtcaaaaagaagctgttgccatcagtgtcaaaaaggtgggatta
cttcttacttacatttctctggaagctttccatggatgtaaaacacattctgttttgtgg
aaacatcacagtacatattgtcagaaaagtccaacgcaagatcttcaccagattcctaat
atttactatgaagtagacatatgggatctgctggcaaatggagtctcaaggaaagttgtc
cctcacgatgatgaactatcacaatttagctggagattttgcaaactgaattctctagaa
atctgcaagggaaaaactaaattgcaggtggaacttgatcaggaatatcaagacaaattc
aaaagactgcctttggaaattctggagtttgtacaggaagccatgaaagggaaaattagt
gaagatggagaccacagttctgccccctcttctctggcatctgacagtgggaaatcaaat
cataaacctctgcaaagtgaagaggaattggaagaagataattcagaaaaagtggaccac
ggagatgcaccatctgaagctaacagtgaacctaggccagcaccagcagaaaatggagta
aatcacactgcctctcttacaccaaaaccagcaactcaggttgtccatagccaaccaaca
ccagaagtggaagcacagactattgaagagctaaaacaacaaaagtcgtttgttaagctt
cagaagaagcactacaaagaaatgaaggaccttgttaagaggcaccacaagaaaaccact
gatcttatcaaagagcacactgcaaagtataatgaaatccaaaatgactatctgcgacga
agagcagttttagaaaaaacagcaaaaagagacagtaagaaaagatctgaaacgggcagc
ccagaccatggttcatcaactatcgaacaagaattggctgcccttgactctgaaatgacc
cagaagctagtcgagctgaaggaaaagcaacagcagcagctgctaaacctccgacaggag
cagtattacagtgaaaagtaccagaagcgagagcacattaagctgctagaggatgctcag
agtaaaagacaggagaaactgatagaaaaacacaaggagattcgtcagcaaatactggat
gaaaagcccaaggttgttttacctaccctggcatgtttgaggctagcagtgtatgaggaa
ggagggaaatttattggccatcggatattaccagtttcagcaattcgaccaggctaccac
tacatctgtttgaggaatgagaggaaccaacctttgacactgccagctctctttgtgtac
atagaggtcaaagactatgtgcctgatacttacgcagatgtgatcgaggccttatccaat
ccaatcagatatgtaaacttgatggagcagagagctaagcagttggcagcactgactctg
gaagatgaagaagaggtaaagaaagaggatccaaagctgcgtgaactgttggatgctggg
aatgttggaagtcgactggaaaatcgaatgataactgttgtctatggaccagacctggtc
aatatatcgtacttgaacttggtggcatttcaagaggatatagcaaaggaatggtcagat
gaagtgttcagtttggcaacaaatttgttggcacagaacatgtcaagggacgcatttctg
gaaaaagcatacacaaaacttaaactacaggtgactccagaaggacgcattcctctgaag
aacatataccgcttgttttctgctgacagaaaacgtgtagagacagcattagaagcctgt
aatcttccatcttccaggaatgattcaatccctcaagatgacttcacacctgacgtgtac
agagtgttcttaaacaacctctgccctcgacctgaaatcgaccacatcttttccgagttt
ggtgccaagagtaaaccataccttactgttgatcagatgatggaatttataaatcttaag
caacgtgatccacgattaaatgaaatcctttatccaccattaaaacaggagcaagttcaa
caactgattgagaaatatgaacccaacagtaacctagcgaagaaaggacagatatcagtg
gatggatttatgcggtatctgagtggagaagaaaatggcgttgttccacctgagaaactg
gatttaaatgaagatatgtctcaaccactgtcacactatttcatcaattcctcacacaac
acctacctcacagctggacagctggctgggaactcttcagtggagatgtatcggcaagtg
cttctgtcaggctgccgctgtgtggagctggactgctggaaagggagaacagctgaagaa
gagccggtcattacgcacgggttcactatgacaactgaaatatctttcaaggaagtaata
gaagctattgctgagtgtgcatttaagacatcgccctttccaatcctcctttcctttgaa
aatcatgtggattcccctaaacaacaggcaaaaatggcagagtactgcagattaatattt
ggagatgcattgcttatggatccattggagaaatacccgcttgaacctggggttcctctt
ccaagccctatggatttaatgtacaaaattctggtaaaaaataaaaagaaatcacataag
tctgcagatggaagtgccaagaagaagctctcagagcaagcctccaacacgtgtagtgat
acatctagtatgttcgagccttcctccccaggagcaggagaagcagagattgagagcgat
gatgatgatgactacgatgatgattgcaaaaagtcgtcaatggatgaaggtaccgctgga
agtgaggctatggccacggaagagatgtctaacctggtgaactacattcagcctgtgaaa
tttgaatcatttgaggtatcaaaaaaacgcaacaaaagttttgaaatgtcttccttcgtg
gaaaccaaagggcttgagcaacttaccaagtctccggtggaatttgtggaatacaacaaa
atgcagctaagccgaatttacccaaaaggaacacgtgtagattcttcaaactacatgcca
caagtcttttggaatgctggctgccaaatggttgctctcaacttccaaacagtagatttg
tctatgcaaataaacatgggaatgtatgagtacaatggcaaaagtggatacaggttaaag
ccagaattcatgagaagaccagacaaacactttgatccatttactgaaagtattgtggat
ggaatcgtagctaacaccttgtctgtgaagattatttcaggtcagtttctttccgataaa
aaagttggtacctatgtagaagttgacatgtttggcctgcctgtggatacaagaagaaaa
gctttaaagaccaagacctcgcaaggcaatgcagttaatcctgtctgggaagaggaaact
atagtgtttaaaaaggttggtgtaacacttgcttctcaaaccagcgttgagtgtgtttaa

KEGG   Meleagris gallopavo (turkey): 664713
Entry
664713            CDS       T01523                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00562  Inositol phosphate metabolism
mgp01100  Metabolic pathways
mgp04020  Calcium signaling pathway
mgp04070  Phosphatidylinositol signaling system
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04270  Vascular smooth muscle contraction
mgp04310  Wnt signaling pathway
mgp04371  Apelin signaling pathway
mgp04540  Gap junction
mgp04621  NOD-like receptor signaling pathway
mgp04912  GnRH signaling pathway
mgp04916  Melanogenesis
Module
mgp_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    664713 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    664713 (PLCB2)
   04371 Apelin signaling pathway
    664713 (PLCB2)
   04020 Calcium signaling pathway
    664713 (PLCB2)
   04070 Phosphatidylinositol signaling system
    664713 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    664713 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    664713 (PLCB2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    664713 (PLCB2)
   04916 Melanogenesis
    664713 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    664713 (PLCB2)
   04270 Vascular smooth muscle contraction
    664713 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    664713 (PLCB2)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     664713 (PLCB2)
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    664713 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    664713 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 664713
NCBI-ProteinID: NP_001290130
Ensembl: ENSMGAG00000003529
UniProt: Q91086
LinkDB
Structure
PDB: 
1JAD

Position
5
AA seq 1211 aa
MSMLTPVLQPPEVKEYLSRGERFIKWDDETASASPVILRVDPKGFYLYWTYQNKEMEILD
ITSIRDTRVGRFAKIPKCQKLREVFNLDYPHSTFLLKTLTIVSGPDMVDLTFHNFVSYKE
NVGKSWAEDIMAIVQNPLTYNASRYTFLEKILVKLKMQLNAEGKIPVRNIFQMFPADRKR
VEAALNACHLPKGKNDAINPEDFPETVYKTFLMNLCPRPEIDEIFTSHHFKAKPYMTKEH
LAKFINKKQRDSRLNDILFPPAKPEQVQSLIEKYEPSVINIQRGQLSPEGMVWFLCGPEN
NVIALDKLVLYQDMTQPLSHYFINSSHNTYLTAGQFSGISSPEMYRQTLLAGCRCVELDC
WKGRPPDEEPIITHGFTMTTEILFKDAIEAIAESAFKTSLYPVILSFENHVDSPKQQAKM
AEYCRTIFGDMLLTEPLEKYPLKPGVPLPSPKDLLGKILIKNKKKQFVSEKRQSSMKKGK
NVEPEIIEQPAFTDAEDTVWAGDVAEEEPEEEDDQLGNLDEEEIKKMQSDEGTAGLEVTA
YEEMSSLVNYIQPIKFDSFEVSAQKNRSYVISSFTELKAYDLLTKFPMQFVEYNKRQMSR
IYPKGTRMDSSNYMPQMFWNVGCQMVALNFQTMDVPMQQNMALFEFNGQCGYLLKHEFMR
RPDKQFDPFSVDRIDVVVASTVSVTILSGQFLSDRSVKTYVEVELFGLPRDTKRKYRTKL
TSTANSINPVWKEEPFVFEKIVMPELASLKIVAFEEGGKFIGHRVIPIIAVHSGYHHVCL
RSESNMPLTMPSLFVYLEVKDYVPDAWADLTIALSNPIKFFNLQEKRSVNLKDGSEVERP
DMQRNFSFPENNGIPESTRIFSTPFANGPAGAAALVKDGNMKEVTQLPEPQTASLAELQQ
MKLFLKLLKKQEKELKELERKGSKRREELLQKYSVLFLEPVYPRGKKRSMHSRKTQKKRS
LTTGDVGTCMQPVEMAEKLDSQVVELKERLEMELIHLGEEYHDGIRRRKEQHATEQTAKI
TELAREKQIAELKALKESSESNIKDIKKKLEAKRLDRIQVMMRSTSDKAAQERLKKEINN
SHIQEVVQTIKLLTEKTARYQQKLEEKQAENLRAIQEKEGQLQQEAVAEYEEKLKTLTVE
VQEMVKNYMKEVFPDGPEIQKEAVLSIPVEEQGSTKQLEEKIPGAEVPRLTAATTEPPGA
ETDINIEESIL
NT seq 3636 nt   +upstreamnt  +downstreamnt
atgtcaatgcttactcctgtcctgcagcccccagaggtgaaggagtatctgtccaggggc
gagcgcttcatcaaatgggacgatgaaacagcaagtgcttctcctgtgattcttcgggtg
gatccaaagggcttttatttatactggacgtatcagaacaaggagatggaaattctggat
ataaccagcatccgagatacccgagtagggcgatttgccaaaatccccaagtgccagaag
ctccgcgaggtttttaacttggattaccctcacagcacctttctgctgaaaactctgacg
attgtatctggccctgacatggtggacctcactttccataactttgtgtcctacaaggag
aatgttggcaagagctgggctgaggatattatggccattgttcagaatcctctcacatac
aacgcttcccggtacaccttcctagagaaaatcctggtgaagttgaagatgcagctgaat
gcagagggaaagattcctgtcaggaatatttttcagatgtttcctgcagacaggaagagg
gtggaagcagcattaaatgcttgtcatcttccaaaaggcaagaatgatgccatcaaccca
gaggacttccctgagactgtgtataaaactttcctcatgaatctgtgtccacggcctgag
attgatgagatatttacttcacaccatttcaaagcaaaaccctacatgaccaaagaacac
ttggcaaagtttatcaacaagaagcagcgagactctcgcctcaatgacatccttttccca
ccagcaaaacctgagcaggtgcagagcctgatagagaaatatgagcccagcgtcattaac
atccagagagggcagttgtctccggagggaatggtctggtttctctgcggccctgagaac
aatgtaatagcactggacaaattggtgctgtatcaggacatgacacagccactctcacac
tacttcatcaattcatcgcacaacacttatttaacagctggccagttttctggtatctca
tctcccgaaatgtaccgtcagacgctgctagctgggtgtcgctgtgtggagctggactgc
tggaagggccgtcccccagatgaggagcccatcatcactcacggattcaccatgacaact
gaaatcctcttcaaggatgcaattgaggccattgcagaaagtgctttcaaaacatctctt
taccctgtcatcctctcttttgagaaccacgtggactcgcccaagcagcaggcaaagatg
gctgagtactgccgaaccatatttggagatatgctgctgacagagcctctggagaaatac
ccactgaagccaggagttcctctgccaagtcctaaggatctcttagggaaaatcctaatt
aagaacaaaaagaaacagtttgtatctgagaagaggcagagttctatgaagaagggaaag
aacgtggaaccagaaatcattgagcagccagcttttaccgatgctgaagatactgtctgg
gcaggtgatgtggctgaggaagaaccagaggaagaggatgatcagctaggaaacctggat
gaagaggaaatcaaaaagatgcagtcagatgagggcactgctggtttggaagtaacagcg
tatgaggaaatgtccagcctcgttaattacatacagcccatcaaatttgactcctttgaa
gtctctgcccagaagaaccggagttacgtaatttcttccttcactgagctgaaggcttat
gatctgctgaccaagttccctatgcagtttgtagaatacaacaaacgccagatgagccgg
atttaccccaaaggcacccggatggactcctcgaattacatgccccagatgttctggaac
gttggctgtcagatggtggcactgaacttccagaccatggatgttcccatgcagcagaac
atggctctgtttgagttcaatggccagtgtggctatctgctcaagcacgaattcatgcgg
cgtccagacaagcaatttgaccctttctcagtggaccgcattgatgtggtggtggcaagc
acagtgtctgtcacgatactttctggtcagttcctctcagaccgcagtgtgaagacatat
gtggaagtggagctgtttgggttgccaagggacacgaagcgcaaatacagaaccaaactg
acctccactgccaattccataaatcctgtttggaaagaagaaccttttgtttttgaaaag
atcgtgatgcctgagctggcatcactcaaaattgtggcttttgaggaaggagggaagttc
attggtcaccgtgtcattcccattattgcagtgcactcaggctatcaccatgtttgtctc
cgcagtgaaagtaacatgccactcaccatgccctctctatttgtgtacctggaagtaaag
gattacgtccctgatgcctgggcagatctgactattgctctctccaacccaattaagttc
ttcaatctgcaagaaaagagatcagttaatctaaaagatggctcagaggtggagaggcct
gacatgcagaggaacttttcatttcctgaaaataatgggataccagaatccaccaggata
ttcagcactccttttgcaaacgggcctgcaggagcagcagctctggtcaaggatggaaac
atgaaggaagtgacacagcttccagagcctcagacagccagccttgcagaactgcagcag
atgaagctgttcctgaagctgctgaagaagcaggagaaagagctgaaggagctggagcgg
aagggaagtaaacggagagaagagttgctacagaaatactctgttctctttttggaacct
gtctaccccagaggcaaaaaaagatccatgcactccaggaaaacccagaagaagaggagt
ttgacgacaggtgatgttggtacctgcatgcaacctgtagaaatggcagaaaagcttgat
agccaagttgtggaactgaaagagaggctggagatggagcttatccacctgggggaagaa
taccatgatggaattcgaagaaggaaagagcagcatgccacagagcaaacggccaagatt
acagagctagccagagagaagcagatagctgagctgaaggcactgaaggagtcatcagaa
agcaacattaaagacattaagaagaagctggaggcgaaacgattagacagaatccaagtc
atgatgaggagtactagcgacaaggctgctcaggagaggttgaagaaagaaattaataac
tctcacatccaggaagtggtccaaacaatcaaactgctgacagaaaagacagccaggtat
cagcagaagctggaagagaaacaggcagagaatctgagagcaattcaagagaaagaaggc
cagctccaacaggaggcagtggcagaatacgaggagaaattgaaaactctgactgtggag
gtgcaggagatggtaaagaactatatgaaagaagtctttcctgatgggccagagattcaa
aaggaagcagttctgagcattcctgtagaagaacaaggttctacaaagcaactggaagag
aagatcccaggggcagaggtgccaagactgacagcagctacgactgagcctccaggagct
gaaacagacatcaatattgaggaaagcatactgtga

DBGET integrated database retrieval system