KEGG   Meleagris gallopavo (turkey): 100547861
Entry
100547861         CDS       T01523                                 

Gene name
CHEK1
Definition
(RefSeq) serine/threonine-protein kinase Chk1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100547861 (CHEK1)
   04115 p53 signaling pathway
    100547861 (CHEK1)
   04218 Cellular senescence
    100547861 (CHEK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100547861 (CHEK1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100547861 (CHEK1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100547861 (CHEK1)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100547861 (CHEK1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100547861 (CHEK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Pkinase_fungal Baculo_VP1054 Paramyxo_P_V_N
Other DBs
NCBI-GeneID: 100547861
NCBI-ProteinID: XP_010722093
Ensembl: ENSMGAG00000016891
LinkDB
Position
26
AA seq 435 aa
MKRAADCPENIKKEICINKMLNHENVVKFYGHRREGATQYLFLEYCSGGELFDRIEPDIG
MPEPEAQRFFQQLIAGVVYLHSMGITHRDLKPENLLLDERDNLKISDFGLATVFKHNGRE
RLLNKMCGTLPYVAPELLRRPEFRAEPVDVWACGVVLTAMLAGELPWDQPSDSCQEYSDW
KERKTYLAPWRKIDSAPLALLHKILTESPTARITIPDIKKDRWFCRPLKKGTKRSRVSSG
GVTESPGALPKHIRSDTDFSPVKGALGEDKASYSTSQPEPGTGGALWDSSMGSIDRLVQG
ISFSQPACPEHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADGSYRSLRDVCEKMG
YGWKQSCTNQVTISTTDRRNNKLIFKVNLLEMESRILVDFRLSKGDGLEFKRHFLKIKGK
LSDVVSSQKVWLPPP
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgaagcgcgcggccgactgcccggagaacatcaagaaggagatctgcatcaacaagatg
ctgaaccacgagaacgtcgtcaagttctacgggcaccggcgcgagggggccacgcagtac
ctcttcctggagtactgcagcggcggggagctcttcgaccgcatcgagccggacatcggg
atgccggagccggaggcgcagcgcttcttccagcagctgatcgctggtgtggtgtacctg
cacagcatgggcatcacgcaccgcgacctcaagccggagaacctgctgctggatgagcga
gacaacctgaagatctccgatttcggcctggccaccgtcttcaagcacaacgggcgcgag
cggctgctgaacaagatgtgtggcacgctgccctacgtggcccccgagctgctgcggcgc
cccgagttccgtgcggagcccgtggacgtgtgggcctgcggcgtggtgctgactgccatg
ctggcgggagagctgccctgggatcagcccagcgacagctgccaggagtacagcgactgg
aaggagaggaagacctacctggcaccctggaggaagatcgactccgcaccattagcactg
ctgcacaagatcctgaccgagagccccacggctcgcatcaccatccccgacatcaagaag
gaccgctggttctgccggcccctgaagaagggcacaaagcgcagccgtgtgtcctcaggt
ggtgtcactgaatcccccggcgccctccccaagcacatccgctctgacacagacttctcc
cctgtgaagggtgccctgggggaggacaaggcgagttactccacatcacagcctgagcct
ggcaccggcggcgcgctgtgggacagcagcatgggcagcatcgaccgcctggtgcagggc
atcagcttctcacagcctgcctgccccgagcacatgctgctcaacagccagctgctcggc
acgccaggctcctcccagaacccgtggcagcgcctggtgaagaggatgacgcgtttcttc
accaagctggacgccgacggctcctaccgcagcctgagggatgtgtgtgagaagatgggc
tacggctggaagcagagctgcaccaaccaggtcaccatctccaccacggaccggaggaac
aacaagctgatcttcaaggtgaacctgctggagatggagagcaggatcctggtggacttc
cgcctctccaagggcgacgggttggagttcaagcggcatttcctgaaaatcaaaggcaaa
ctgagcgacgtggtcagcagccagaaggtgtggctgcccccaccctga

DBGET integrated database retrieval system