KEGG   Meleagris gallopavo (turkey): 100547897Help
Entry
100547897         CDS       T01523                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00052  Galactose metabolism
mgp00500  Starch and sucrose metabolism
mgp01100  Metabolic pathways
mgp04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100547897
   00500 Starch and sucrose metabolism
    100547897
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100547897
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100547897
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100547897
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100547897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 RL11D
Motif
Other DBs
NCBI-GeneID: 100547897
NCBI-ProteinID: XP_010717953
Ensembl: ENSMGAG00000002593
LinkDB All DBs
Position
16
AA seq 932 aa AA seqDB search
MRSYQKLRTAVPQLVLSQEEEEEEENATTPTPAGRSKLAPWWVGSGLLITAVLLSTITVW
VLRQVSRGWHGPAPPSQCHLVPESHRYDCYPERSVVVTQELCESRGCCFIETLPAXGGKQ
GVPWCFYPPNFPSYVVQSLNQTALGMTGLLVRREKAYYPKDIQVLRMDVEFQTNTRLRIK
ITDAAKPRYEVPLEVPRVMKRAENPIYSLEFSQDPFGVLLRRQGTGTVLLNTTVAPLIFA
DQFLQISTTLPSRFLYGLGEHRSTLLHSLDWNTLTLWARDVAPTESFNLYGAHPFYLLME
EGGDAHGVFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPDPNMVIQQYQEVIGFPA
MPPLWALGFHLCRWGYGSSNETWQTARAMRNFQIPQDAQWNDIDYMDGYRDFTFDPQRFA
SLPSLVEDLHKHGQRYVMILDPGISSTSPRGSYWPFDEGLRRGLFLNTTQGQPLIGQVWP
GYTAFPDFSNTDTHQWWLENLQRFHTHVPFDGLWIDMNEPSNFMDGSEEGCPPGELDSPP
YTPAVLGNSLSAKTVCASAKQNASVHYNLHNLYGLKEAEATASALIQIRGKRPFVISRST
FPSQGRYSGHWLGDNRSQWKDMYYSIPGILSFSLFGIPLVGADICGFSGSTSEELCTRWM
QLGAFYPFSRNHNTQNEKAQDPTAFSPSARTAMKDVLLTRYSLLPFLYTLFHRAHLQGET
VARPLFFEFPWDVATYGLDRQFLWGQSLLVTPVLEPGADSVLGYFPQGVWYDFYTGSSVN
SSGEMLKLSAPLDHLNLHLREGSILPTQKPSTTSNATRGNPLRLIVALSPRATAWGDLFW
DDGESLDTFEQGNYSYLVFNATENIFTSNVLHASSEAAYVTVDAVSFYGVQEPPSKVLLD
GQEKPFSYLDNQVLTVSGLGLGLSQGFSLQWL
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgtaccagaagctgaggacggcggtgccacagctggtattgagccaggaggag
gaggaggaggaggagaatgcgaccaccccgacacctgctggccgcagcaagctggcccca
tggtgggtgggcagcgggctgctgatcaccgccgtgctgctgagcaccatcaccgtctgg
gtgctgcgacaagtatccaggggctggcatggccctgcaccaccttcccagtgccacctg
gtccctgagagccaccgctatgactgctaccctgagaggagcgtggtggtgacccaggag
ctgtgcgagagccgggggtgctgcttcatcgagaccctccctgcangtgggggcaagcag
ggggtgccctggtgcttctacccacccaacttccccagctacgtggtgcagagcctcaac
cagacagcgctgggcatgacggggctgctggtgcgcagggagaaggcctattaccccaag
gacatccaggtgctgaggatggacgtggagttccagacgaacacacggctgcgcatcaag
ataaccgatgcagccaagccccggtatgaggtgcccctggaagttccccgagtgatgaag
agagcagaaaaccccatctacagcctggaattctcccaggacccctttggggtgctgctg
cggcgccaagggacagggacagtgctgctcaacaccaccgtggctcccctgatcttcgcc
gatcagttcctgcagatctctaccacgctgccctccaggttcctgtacgggttgggggag
caccgcagcacgctgctgcacagcctcgactggaacaccctcaccctctgggcccgtgat
gtggcccccacggaatccttcaacctgtacggcgctcaccccttctacctgctgatggag
gagggcggcgatgcccacggggttttcctcctcaacagcaatgccatggaggtggccctg
cagcctgccccgggcctgacttggaggaccattggaggtgtgctggacttctacatcttc
ctggggcctgaccccaacatggtcatccagcagtaccaggaggtgataggtttcccagcc
atgccgccgctctgggcgctcggcttccacctctgccgctggggctacggctccagcaat
gagacctggcagactgcaagggccatgaggaacttccagatcccacaggatgcgcaatgg
aatgacattgattacatggatgggtaccgggacttcaccttcgatccccagagatttgcc
tctctcccctcactggtggaagatctccacaagcacgggcagcgctacgtgatgatcttg
gaccctggcatcagcagcaccagcccacgtggctcctactggccttttgatgaaggcttg
agacggggtttgttcctaaacaccacccaggggcagccgctgattgggcaggtctggccc
ggctacactgccttccccgacttctccaacacagacacacaccagtggtggctggagaac
ctgcagcgcttccacacccatgtgcccttcgatggcctctggatcgacatgaacgagcca
tccaacttcatggatgggtctgaagagggctgcccgcccggagagctcgacagccccccg
tacacgccggctgtgctgggcaattccctgtccgccaagacggtgtgtgcctcagcgaag
cagaacgcctcggtgcactacaacctgcacaacctctacgggctgaaggaagccgaagcg
acggcgagcgccttgatccagatccgaggaaagcgtccctttgttatctcccgctccacc
ttccccagccagggccggtactcgggacactggctgggtgacaaccggagccaatggaag
gacatgtattactccatcccagggattctgagcttcagcctgtttgggatccctctggtg
ggggccgacatctgcggcttctccggaagcacctcggaggagctgtgcacccgctggatg
cagctcggggctttctaccccttctcccgcaaccacaacacccagaacgagaaggcccag
gaccccacagctttcagcccctcggcgaggacagccatgaaggacgtactgctcacccgc
tactccctcttgcccttcctctacacacttttccaccgtgcccacctgcaaggggaaacc
gtcgcccgacctttgttctttgagttcccctgggatgtggccacgtatgggttggacagg
cagttcctgtggggccagagcttgctggtgacgccggtgctggagcctggagcagactca
gtgttgggctatttcccccaaggcgtgtggtacgacttctacacgggctcctctgtgaac
agcagtggggagatgttgaagctgtcagcccctctggaccacctcaacctccatctccgg
gagggttccatcctgcccacacagaaacccagcaccaccagcaacgccacccgagggaac
ccgctgcgactcattgtggccctgtccccacgtgccactgcctggggggacctcttctgg
gatgacggcgagagcctggacaccttcgagcagggcaactactcctacctggtgttcaat
gccacagagaacatcttcacctccaacgtcctccatgccagttcagaggccgcctatgtc
accgttgatgcagtgagcttctatggagtgcaggagccgcccagcaaggtcctcctagat
gggcaggagaagcccttctcctacctggacaaccaggtcctcaccgtcagcggcctcggc
ctcgggctcagccagggcttctccctgcagtggctgtga

DBGET integrated database retrieval system