KEGG   Meleagris gallopavo (turkey): 100548073
Entry
100548073         CDS       T01523                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04217  Necroptosis
mgp05164  Influenza A
mgp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100548073 (BID)
   04217 Necroptosis
    100548073 (BID)
   04115 p53 signaling pathway
    100548073 (BID)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100548073 (BID)
   05168 Herpes simplex virus 1 infection
    100548073 (BID)
SSDB
Motif
Pfam: BID Bcl-2 DUF3349 CRM1_C
Other DBs
NCBI-GeneID: 100548073
NCBI-ProteinID: XP_010712302
LinkDB
Position
1
AA seq 233 aa
MENACALEAVVCDGQVLRNSRVRISDLKQTVTSCSLSESIMERDIYSDGSDHMERMLLFA
FLAESSGCEFREQLPFLQSRGLLCAVKGVQSYDSDGELQTDGNRSGHLQNGELVLDPEVN
EEIVRTIAAQLAEIGDQLDKQIKAKVVNDLVQHFLNENLPREEITRCLSQAVEGLARAVP
SDLEQEKAMLVLAMLLTKKVANQVPSLLQRVFSTTVNYISQHLHNYIVRMLRE
NT seq 702 nt   +upstreamnt  +downstreamnt
atggagaatgcctgcgctttggaagctgttgtctgtgatggacaagtcctgagaaattcc
agggtaaggatttctgatctgaagcagactgtgacgagctgttctctctctgaatccatc
atggaacgggatatctatagtgatggatctgaccatatggaacgcatgctgctctttgct
ttcctggcggagtcctctggctgtgagttcagagagcagctgccattcctacaaagccgg
ggcctcttgtgtgccgttaaaggtgttcaatcttatgatagtgatggggaacttcagacc
gatgggaatcgaagcggccacttgcagaatggtgagctagtgcttgaccctgaggtaaat
gaagaaattgtccggaccattgctgctcagctcgctgagatcggagaccagctggataaa
caaatcaaagcaaaagtagtaaatgatctagtgcaacattttctgaatgagaatttgcct
agagaggagataacacggtgcctgtcacaggcagtggaaggacttgccagagccgtccca
tcagatctggagcaagagaaggccatgttggtgctagcaatgctcttaactaagaaagtg
gcgaatcaagtgccttcccttctacagcgtgtcttcagcaccactgtgaactacatcagc
caacatctccacaactacattgtcagaatgctgcgcgagtga

DBGET integrated database retrieval system