KEGG   Meleagris gallopavo (turkey): 100548295Help
Entry
100548295         CDS       T01523                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00500  Starch and sucrose metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100548295
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100548295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100548295
NCBI-ProteinID: XP_010713945
Ensembl: ENSMGAG00000006347
UniProt: G1N3Q5
LinkDB All DBs
Position
10
AA seq 512 aa AA seqDB search
MQVLLLLAAVGLCWAQYNPNTQAGRTSIVHLFEWRWADIALECERYLAPYGFGGVQVSPP
NENIVITNPNRPWWERYQPISYKICSRSGNENEFRDMVTRCNNVGVRIYVDAVVNHMCGS
MGGTGTHSTCGSYFNTGSRDFPAVPYSAWDFNDGKCQTASGDIENYGDIYQVRDCKLTSL
LDLALEKDYVRSTVAAYMNHLIDIGVAGFRIDAAKHMWPGDIRAFLDKLHDLNTQWFSAG
TKPFIFQEVIDLGGEPITGSQYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RYFENGADVNDWVGPPSNSDGSTKSVTINADTTCGNDWVCEHRWRQIRNMVVFRNVVDGQ
PFSNWWDNGSNQVAFGRGNRGFIVFNNDDWYMNVNLQTGLPAGTYCDVISGQKEGSACTG
KQVYVSSDGMANFQISNSDEDPFVAIHVDAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtccttctcctcctcgcagctgtagggctttgctgggcgcagtataaccccaac
actcaggctgggaggacgtctatcgtgcatctctttgaatggcgctgggccgatattgct
ctggagtgtgaacgctatttagctccttatgggtttggaggagttcaggtttctcctcca
aatgaaaacattgtcattactaatccgaaccggccctggtgggaaagataccagcccatc
agctacaagatctgcagtcgatcgggcaatgaaaatgaattcagagacatggtgaccaga
tgcaacaacgttggagttcgtatttatgtggatgctgttgtcaatcacatgtgcggatct
atgggtggcacaggcacccactcaacgtgcgggagctatttcaacaccgggagtagagat
tttcccgctgtgccatattctgcctgggatttcaatgatggcaaatgtcagactgcaagt
ggggacatcgaaaattatggggacatatatcaggtccgggattgtaagttgaccagcctt
ctcgatctggctctggagaaggactatgtacgctcgacagttgcagcatacatgaatcac
ctcattgatataggtgtagcagggttccggattgatgctgccaagcatatgtggcctggg
gacataagggcgtttctggacaaattgcacgatctaaatactcagtggttttcagcagga
acaaaaccctttattttccaagaggtaattgacttgggaggagagccaatcacaggcagt
cagtactttggaaatggccgagtgacagagttcaagtacggtgcaaaactggggacggtg
atccgcaagtggaacggagagaagatggcctacttaaagaactggggagaaggctggggc
tttgtgccttctgacagagccctggtctttgtggataaccacgacaaccagcgcgggcac
ggggcaggcggagcttccattcttaccttctgggatgccaggctttataaaatggcagtc
ggtttcatgctcgctcatccgtacggcttcacgcgggtgatgtcaagttatcgttggccg
agatatttcgagaatggagcggatgtcaacgactgggttggtccgcccagtaactcggac
ggatcgacgaagtccgtgacaatcaatgcagacactacttgcggcaacgactgggtctgt
gaacatcgctggcgacaaataaggaacatggttgtcttccgtaacgtggtagacggtcag
cctttctcaaactggtgggacaacgggagcaatcaagtagcttttggtcgcggcaacaga
ggcttcattgtctttaataatgacgactggtatatgaacgtcaatttgcaaacggggctg
cccgccggtacctactgcgatgttatttccggacaaaaggaaggcagtgcgtgtactgga
aagcaggtgtatgtttcctcggatggaatggccaatttccagattagtaacagtgatgaa
gatccatttgttgcaattcacgttgatgccaagttataa

DBGET integrated database retrieval system