KEGG   Meleagris gallopavo (turkey): 100548554
Entry
100548554         CDS       T01523                                 

Gene name
PRKACB
Definition
(RefSeq) LOW QUALITY PROTEIN: cAMP-dependent protein kinase catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04020  Calcium signaling pathway
mgp04114  Oocyte meiosis
mgp04140  Autophagy - animal
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04270  Vascular smooth muscle contraction
mgp04310  Wnt signaling pathway
mgp04340  Hedgehog signaling pathway
mgp04371  Apelin signaling pathway
mgp04530  Tight junction
mgp04540  Gap junction
mgp04910  Insulin signaling pathway
mgp04912  GnRH signaling pathway
mgp04914  Progesterone-mediated oocyte maturation
mgp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100548554 (PRKACB)
   04310 Wnt signaling pathway
    100548554 (PRKACB)
   04340 Hedgehog signaling pathway
    100548554 (PRKACB)
   04371 Apelin signaling pathway
    100548554 (PRKACB)
   04020 Calcium signaling pathway
    100548554 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100548554 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100548554 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100548554 (PRKACB)
   04540 Gap junction
    100548554 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100548554 (PRKACB)
   04912 GnRH signaling pathway
    100548554 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100548554 (PRKACB)
   04916 Melanogenesis
    100548554 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100548554 (PRKACB)
   04270 Vascular smooth muscle contraction
    100548554 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100548554 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mgp03019]
    100548554 (PRKACB)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100548554 (PRKACB)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100548554 (PRKACB)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: AGC group
  PKA family
   100548554 (PRKACB)
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100548554 (PRKACB)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100548554 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 100548554
NCBI-ProteinID: XP_031410720
Ensembl: ENSMGAG00000006417
LinkDB
Position
10
AA seq 398 aa
MATQKEVPCAQCTGTATALQRLEGFANRLFHRHSKGSAHELRVALENENHQFSELAVLWD
KSMKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASXNRKCAKEFADF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcaactcagaaagaggtaccttgtgcccagtgcacggggacagccaccgcactgcag
agactggaaggtttcgctaatcgccttttccataggcattcaaagggcagtgcacatgaa
ctgagagtggctctggaaaatgagaaccatcagttctctgaacttgctgtcctatgggac
aaatcaatgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagc
ccacctcagaatactgctggcctagatgattttgagaggcaaaaaactcttggaacagga
tcatttgggagagttatgatggtgaagcataaagccacagaacagtattatgccatgaag
atactggacaaacaaaaggttgtcaagctgaagcagatagaacacacactgaatgaaaag
agaatattacaagcagtgaactttcctttccttgtaaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggtgaaatgttctcacatcta
agaagaatcggaaggttcagtgaaccacacgcacggttttacgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaa
ggaagaacttggacattatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcagtggattggtgggcattaggagtgttaatctatgaaatggca
gctggatatcccccattctttgcagatcaacccattcaaatttatgagaagattgtgtct
ggcaaggtaaggttcccatcacacttcagttcagatctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacgatatggaaatctcaagaatggtgtaaatgacataaag
aaccacaagtggtttgcgactacagattggattgccatttatcagagaaaggtagaagct
ccattcataccaaagtgcagaggccctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcgtctnctaacagaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system