KEGG   Meleagris gallopavo (turkey): 100548596
Entry
100548596         CDS       T01523                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
mgp04115  p53 signaling pathway
mgp04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100548596 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100548596 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100548596 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mgp04121]
    100548596 (DDB2)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100548596 (DDB2)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100548596 (DDB2)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100548596 (DDB2)
SSDB
Motif
Pfam: WD40 Nucleoporin_N
Other DBs
NCBI-GeneID: 100548596
NCBI-ProteinID: XP_003206463
Ensembl: ENSMGAG00000010763
LinkDB
Position
5
AA seq 507 aa
MAPVNQPKDKKHEKTHEHRSEEAISAGKRKLDYEGLENVPLAKKLFLRKTSKAQEKIGWN
RGGTVMKSTRAFFHQPKWQGSIVHYVYQNMLGGSIRAQLRQCLQLPFLRSLTSYRLFRTA
SPFDRRVTCLEWHPTHPSTVAVGSKGGDIILWDYEVLTKTCFIKGKGPGDSLGDIKFSPY
EAVKLYVASGDGTLSLQDLEGRAVQVISRAPDCGHENHNVCCWYCSVDVSASCRAVVTGD
NLGNVVLLSTSGEEIWRLKLHKKKVTHVEFNSRCEWLLATASVDQTVKIWDLRNIKDKAN
FLHVLPHDKPVNAAYFSPTDGAKLLSTDQRNEIRVYSCSDWTKPQHLIPHPHRQFQHLTP
IKATWHPRYDLIVVGRYPDPKFPGYTVNELRTVDIFDGNTGEMACQLYDPNASGIISLNK
FNPMGDTLASGMGFNILIWSREEMVMKKQEHLLKAMTEQGIGSRSLSRRGGQRQANPGTS
KLKAKLLSWEVEEMGTKPKDSKSRGRK
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggctccagtgaaccagcccaaggacaagaagcatgaaaagacacatgagcatcggtca
gaagaggcaatatcagctgggaaaaggaaactggactatgaaggactagagaatgtgcca
ctagcaaagaaattgtttttgaggaaaacatccaaagcccaagagaaaattggttggaac
agaggtgggactgtgatgaaaagtaccagagcctttttccatcagccgaagtggcagggc
agcattgttcattacgtctaccagaacatgctgggaggctccatccgggcacagctcagg
cagtgtctacagctgccctttctgcgttcactgacctcataccgcctttttcgaacagca
agtccctttgacaggagagtgacttgcctggagtggcatccaacacaccctagtactgta
gctgttggttccaaaggtggagacatcattctttgggactatgaagtacttactaaaacc
tgcttcataaaagggaaagggccaggagattctcttggagacatcaagttcagtccttat
gaggcagtgaagctttatgtggcatcaggggatggcaccctaagtctgcaggaccttgag
ggcagagcggtgcaagtgatctcccgtgccccggactgtggccacgagaaccataatgtt
tgctgctggtactgcagtgttgatgtttctgcaagctgccgtgctgtggtgacaggtgat
aatttgggcaatgtggtcctgctcagcacttctggtgaagagatttggaggctgaaactg
cacaagaagaaagtgactcatgtggagtttaactctcgatgtgagtggttattggccaca
gcatctgtggatcagacagttaaaatctgggacctcagaaacattaaagacaaagcaaat
tttcttcacgtacttcctcatgacaaacctgtcaatgcagcttacttcagcccaacagat
ggtgccaagctgctgagcacagaccagcgcaatgaaatcagggtttattcatgttcagac
tggaccaagcctcagcatctcatcccacacccacatcggcagttccagcacctcacacct
attaaggcaacgtggcatcctcgctatgatctcatcgtggtgggtcgctatccagacccg
aagttcccaggctacacagtgaatgagctgcgaactgttgatatatttgatggaaacacc
ggggagatggcttgtcagctctatgatccgaatgcatctggtataatctcgctgaataaa
tttaaccctatgggagacacactagcctctggcatgggctttaatattctgatctggagc
cgggaggagatggtgatgaagaagcaagagcatcttttgaaagccatgacagagcagggg
attgggagccggagtttatccagacgtggagggcagagacaggcaaaccctgggacaagc
aaactcaaagctaagttattgtcttgggaagtggaagagatgggaacaaaacccaaagat
tctaaatcacggggaaggaagtga

DBGET integrated database retrieval system