KEGG   Meleagris gallopavo (turkey): 100548600
Entry
100548600         CDS       T01523                                 

Gene name
STEAP3
Definition
(RefSeq) metalloreductase STEAP3
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100548600 (STEAP3)
   04115 p53 signaling pathway
    100548600 (STEAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100548600 (STEAP3)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     100548600 (STEAP3)
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Others
   Others
    100548600 (STEAP3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct 2-Hacid_dh_C IlvN NAD_binding_2 Shikimate_DH
Other DBs
NCBI-GeneID: 100548600
NCBI-ProteinID: XP_003207737
Ensembl: ENSMGAG00000012322
LinkDB
Position
7
AA seq 560 aa
MVGECCSTGTPQQLCSHRVAGDSLSTQQCCPSSRGPGVASGLCCWHFLILTAWLASWGRF
ATSLFWLKQYRRMPGGDMAKPLLGHRSTEGDPSVVPAAGRTIGVLGSGDFARSLAIRLVC
SGFKVVVGSRNPKRKACLFPSAAEVTFQAEAVKKTDVIFVAVFREHYSTLCDLADVLAGK
ILVDVSNNTEINHHKESNAEYLASLFPACTVVKGFNVVSAWTLQSGARDGNKQVLICSNS
QEAKRTVAEIAQIMGFTPVDMGCMSSACEIENIPLRLLPAWKIPILLALGLFLCFFTYNL
VRQVIHPYIREQKNKFYKIPVEVVNTTLPCVAYVMLSLVYLPGVLAACSQLYYGTKYRRF
PDWLDQWLQHRKQIGLLSFFCAALHAVYSLCLPMRRSHRYQLIETAVKQAMEKKMNIWVE
EEVWRMEIYISVGIIALGLLSLLAITSLPSIANSLNWREFSFIQSTLGFIALVTSTLHTL
TYGWSRAFDENQYKFYLPPTYTLTLLVPCTVILAKVAFSLPCIQHRLQRIRRGWEKGRYV
KFVLPSATGEYSSGETSSNV
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggtgggggaatgctgcagcactgggacccctcagcagctctgttcccaccgtgtggct
ggggacagcctcagcacccagcagtgctgccccagcagtcggggacctggggttgcctca
gggctctgctgttggcatttcctcattctcacagcctggctggcatcctgggggaggttt
gcgacatcgctgttctggctgaagcagtacagacggatgcctggaggagacatggccaag
cccctccttggccacaggagcacagagggtgaccccagcgtggtgcctgcagctggccgc
accattggcgtgctggggagcggggactttgcacgctcgttggccatccgtctggtgtgc
tctggcttcaaggtggtggtgggcagccgcaacccaaagcgcaaagcctgtctcttccct
tctgcagcagaggtcaccttccaggctgaggcggtgaagaagacggatgtcatttttgtg
gcggtttttagggaacattactccacgctctgtgacctggctgatgtgctggcgggcaag
atcctggtggatgtcagtaacaacactgaaatcaaccaccacaaagaatccaacgctgaa
tacttggcctctctgttccccgcctgcactgtggtcaagggctttaatgtggtttctgcg
tggacgctgcagtctggtgccagggatggcaataagcaggttctgatctgctccaatagc
caagaagccaagcgtactgttgcagaaattgctcagatcatgggcttcacccctgtggac
atgggctgcatgtcctcagcctgtgagattgagaatattcccctgcgccttttgccagcg
tggaaaatccccatccttttggctctggggctctttctttgctttttcacttacaacctg
gtgcggcaggtcatccacccttacatcagggagcagaagaataagttttataagatccct
gtcgaggtggtcaacactacgctgccatgcgtggcctacgtcatgctgtctctggtctac
ctccctggtgtgctggcagcctgctcgcagctctactacggcaccaaatacaggcgcttt
ccagactggcttgaccagtggttgcagcacagaaagcagatcggcctcctcagcttcttc
tgtgcagccctgcacgctgtgtacagcctgtgcctgcccatgcgccgctcccaccgctac
cagctgattgagacggccgtcaagcaggctatggaaaagaagatgaatatctgggtagag
gaggaagtctggaggatggagatttatatctctgttggaataattgccctgggcttgctg
tcgttacttgccatcacctcacttccatccatcgcaaactctctcaactggagggaattc
agtttcatccagtctaccctgggatttattgccttggtcaccagcaccctgcacaccctc
acatatggctggtcaagggcctttgatgagaaccaatacaagttctacctgcctcccacc
tacacgctcacactgcttgtcccatgtactgtgatcctagcaaaagttgccttcagtttg
ccctgcattcaacacagactccagcgaatcagaagaggctgggagaaggggaggtacgtc
aagtttgtcctgcccagtgcaacaggggagtattcgagtggggagacctctagcaacgta
tga

DBGET integrated database retrieval system