KEGG   Meleagris gallopavo (turkey): 100548790Help
Entry
100548790         CDS       T01523                                 

Gene name
CNIH3
Definition
(RefSeq) cornichon family AMPA receptor auxiliary protein 3
  KO
K20368  protein cornichon
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100548790 (CNIH3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mgp02000]
    100548790 (CNIH3)
Membrane trafficking [BR:mgp04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    100548790 (CNIH3)
Transporters [BR:mgp02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   100548790 (CNIH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 100548790
NCBI-ProteinID: XP_003203886
Ensembl: ENSMGAG00000008216
UniProt: G1N827
LinkDB All DBs
Position
2
AA seq 160 aa AA seqDB search
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPAHARERLRNIERI
CFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFRCPADSSELAYDPP
AVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaccttcgctgctttctgctacatgctgtcgctcgtcctttgcgccgcgctc
atcttcttcgccatctggcatataatcgcctttgatgagctacggacggacttcaaaagc
ccaatagatcagtgcaacccagcccacgcaagagagcggctgagaaatattgaacgtatt
tgcttcctcctgcgaaagctggtgttgccggagtactccatccatagccttttctgcata
atgtttttgtgtgctcaggaatggctcacactgggcttaaatgttcctctgcttttttat
cacttctggaggtattttcgttgcccagcagatagttcagaactcgcttatgatccgcct
gcagtcatgaatgctgataccttgagttactgtcaaaaagaggcctggtgtaagctagct
ttctatctcctttctttcttctactatctttactgcatgatctacactttggtgagctct
taa

DBGET integrated database retrieval system