KEGG   Meleagris gallopavo (turkey): 100548976Help
Entry
100548976         CDS       T01523                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00052  Galactose metabolism
mgp00500  Starch and sucrose metabolism
mgp01100  Metabolic pathways
mgp04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100548976 (GAA)
   00500 Starch and sucrose metabolism
    100548976 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100548976 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100548976 (GAA)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100548976 (GAA)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100548976 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100548976
NCBI-ProteinID: XP_010719733
Ensembl: ENSMGAG00000006075
LinkDB All DBs
Position
20
AA seq 845 aa AA seqDB search
MREEEMDLRFLGEVSAPGSSCPSQLRRGHIRGPGERTRARTGQQSRESRESGRERTRLGW
GLRDFVGDVYCEDSEMGKVGVALETESRLRFTLRDPARQRYEVPMATPRVSIRAADALYG
VQLLQDPFGIVVFRQPGGQVLLNTSVAPLFFADQFLQISTSLPSRFISGLGERLTPLILD
TAWTKVTLWNRDMAPAPQVNLYGSHPFYLVLEDGGSAHGVFLLNSNAMDVLLQPSPALTW
RTTGGILDFYVFXGPDPQNVVRQYLDVVGFPFMPPYWALGFHLCRWGYSSTATTRQAVAN
MSAGRFPLDVQWNDLDYMDAKRDFTYNKETFRDYPDMVHDFHQRGLRYVMIVDPGISSSG
PPGTYWPYDDGLKRGVFIRNATGQPLIGKVWPGPTAFPDFTNPETHEWWHDMVKDFHQRV
PFDGMWIDMNEPSNFVEGSQDGCPDSSLEKPPYVPGVFGGRLQAGTICASSQQHLSSHYN
LHSLYGLTEAIASHNALLRVRGTRPFVISRSTFAGHGHYAGHWTGDVESSWEQLARSVPE
VLLFNLLGVPLVGADICGFAGDTSEELCVRWTQLGAFYPFMRNHNDHGNRPQEPYAFGLA
AQDAMRRALRLRYSLLPHLYTLFHRAHVAGDTVARPLFLEFPKDPNTWSVDRQLLWGAGL
LITPVLEQGQTKVSGYFPVGTWYSFTGDSTIHSKGQWILLAAPLDTINVHIRAGHILPLQ
EPGLNTVESRKKGMTVVVALTPDGFARGELYWDDGESWQSFEKGDCTEILFLAARGAVLS
QILRAGGHLDGILLEAVTVLGVPSAPQRVLANGVPVEDFSYRSDTQVLRVSVSLPMWEQF
VVAWS
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaagaagaaatggacctgcgatttcttggtgaggtgagcgcacccggctccagc
tgcccctcgcagctccggcgggggcacatccgtggcccgggagaaaggacccgagcccgg
acgggacagcagtcccgggaatcgcgggagtcggggagagagcgcacgcggttgggttgg
ggtctgcgggacttcgtgggggatgtttattgtgaagactccgagatgggaaaagtgggc
gtggcgctggagaccgagagccgcctgcgcttcacgctccgcgatccggcgcggcagcgc
tacgaggtgcccatggccacaccgcgggtgagcatccgtgcggccgacgcgctgtatggg
gtgcagctgctccaggacccgttcggcatcgtcgtgttccggcagcccggcgggcaggtc
ctgctcaacaccagcgtcgctccgctgttctttgcggaccagttcctgcagatttccacc
tctctgccctctcgtttcatttctgggctgggggagcgcctgacccctctcatcctcgac
acggcctggaccaaggtcacactgtggaaccgggacatggcacccgcgccccaggtcaat
ctctatggttcccatcccttctacctggtgctggaggacggtggctctgcgcatggtgtc
ttcctgctgaacagcaatgccatggatgtgctcctgcagcccagcccagccctgacctgg
cgcacaacaggaggcatcctggacttctatgtctttnttgggcccgacccccagaatgtg
gtgcggcagtacctggatgtcgttgggttccccttcatgcccccatactgggccttgggc
ttccacctgtgccgttggggttattcttccactgccaccacccggcaggctgtagccaac
atgtcggctgggcgcttccccctggatgtacagtggaacgacctggattacatggatgca
aagagggactttacctacaacaaggaaaccttcagggattaccccgacatggtgcacgac
ttccatcagcgtggcctgcgctatgtcatgattgtggatcctggcatcagcagctcaggg
ccacctggcacctattggccctacgacgatggactgaagcgaggagtgttcatccgcaac
gccacggggcaaccacttattgggaaggtgtggccaggccccacggctttcccagacttc
accaaccctgagacgcacgagtggtggcacgacatggtgaaggacttccaccagcgggtg
ccatttgatggcatgtggattgacatgaatgagccgtccaactttgtggagggctcccag
gacggctgccctgacagcagcctggagaagcccccatacgtgccaggtgtgtttgggggc
cgcctgcaggcaggcaccatctgtgcctccagccagcagcacctgtcctcccactacaac
ctgcacagcctgtacgggctgaccgaggccatcgcctcccacaatgcactgctcagggtg
cggggcacgcggcccttcgtcatctcgcgctccacgtttgcgggacacggccattatgca
gggcactggacaggggatgtggagagcagctgggagcagctggcccgctccgtgccagag
gtgctgctcttcaacctcctcggggttccactggtgggtgctgacatctgtggctttgcg
ggtgacacgtccgaggagctgtgcgtgcgctggacccagctgggtgccttctaccccttc
atgaggaaccacaacgaccacgggaaccggccacaggaaccctatgcctttggcctggct
gcacaggatgccatgaggagggccctccgcctccgctactccctcctgccccacctttac
accctcttccaccgggcacacgtggctggggacacggtggcacggccactgttccttgag
ttccccaaagatcccaacacgtggagcgtggaccgccagctgctgtggggcgcagggctg
ctgatcacgccggtgctggagcagggacagaccaaagtcagtggctatttcccagttggg
acgtggtacagcttcacaggggactcgaccatccacagcaaagggcaatggatcctttta
gcagcccccctggacaccattaacgtgcacatccgagcagggcacatcctgcccctgcag
gagcccggattgaacacagttgagtcccgcaagaaggggatgaccgtggtggtggccttg
acgccggatggcttcgcccgtggagagctgtactgggacgatggggagagctggcagagc
ttcgagaagggggactgcactgagatcctcttcctggctgcacgcggtgccgtgctcagc
cagatcttgcgggcgggtggccacctggatgggatcctgctggaggccgtcaccgttctg
ggcgtccccagtgctcctcagcgagtcctggccaatggggtccccgtggaggacttctca
taccgcagcgacacccaggtgctgcgtgtctccgtgtcgctgccgatgtgggagcagttt
gtggtcgcttggtcctga

DBGET integrated database retrieval system