KEGG   Meleagris gallopavo (turkey): 100549365
Entry
100549365         CDS       T01523                                 

Gene name
CYC
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp05132  Salmonella infection
mgp05164  Influenza A
mgp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100549365 (CYC)
   04115 p53 signaling pathway
    100549365 (CYC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100549365 (CYC)
  09172 Infectious disease: viral
   05164 Influenza A
    100549365 (CYC)
   05168 Herpes simplex virus 1 infection
    100549365 (CYC)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 100549365
NCBI-ProteinID: XP_003207183
Ensembl: ENSMGAG00000010618
UniProt: P67882
LinkDB
Position
6
AA seq 105 aa
MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERVDLIAYLKDATSK
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagatattgagaagggcaagaagatttttgtccagaaatgttcccagtgccataca
gttgaaaaaggaggcaagcataagactggacccaatctccatggcctgtttggacgcaaa
acagggcaagctgaaggtttctcttacacagatgctaataagaacaaaggtatcacttgg
ggtgaggatactctgatggagtatttggaaaatccaaagaagtacatcccaggaacaaag
atgattttcgcgggtatcaagaagaagtctgagagagtagacttaatagcatatctcaaa
gatgccacttcaaaataa

DBGET integrated database retrieval system