KEGG   Meleagris gallopavo (turkey): 100549398
Entry
100549398         CDS       T01523                                 

Gene name
GTSE1
Definition
(RefSeq) G2 and S phase-expressed protein 1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100549398 (GTSE1)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 100549398
NCBI-ProteinID: XP_019475928
Ensembl: ENSMGAG00000007521
LinkDB
Position
1
AA seq 727 aa
MEEGREMALPRSGRVVEEKPSACIGVSDFPLLADEKFDFDLSLSPSSGSEDEVFIGSLGH
KEKCIAVNIEAKSAEKKKVPTSDDKLTWSPLIGDKFVEIFKEAHLLALQIESGNKSEENK
VSQSEGNGNETSEQFVEDLKSKMKILKSHHIEKSPRAVKRETYCVGDSPACMLLPSFQKE
SDKLLSGDKTHILHIPSDESPVKIQAAPTETISSPLTQVQKTKEKTKKATGKLLMPKLSS
TLGKSSMLTVEKAKPGKQTSISTKGDLTSVGSSEDLISDKSSAASDVFESSLSGSSSVQD
KKVLPAPNKPGLESWFKKTHLKLPGVASGLARKSTSSSSSVSSVSSNLNSSLPISPIGKN
GKSNATSKTGVSGSKPSAGTNRLSLARPTRVSSLQAVNTERSSKQARSASTPKISSAASL
AKSSASALTVPSEPEGSGIQRLRSLPSLQKLCQQNKDGITTKGSLCPKPRARLLSVPAGQ
TQVPVKAGDITPNKSATKATPSLGLTFCGKVGSAMAVSTPLKAFEDGIFQIPCERPVSMT
PGSLKRSAIPTPVRRISGFPAATPKTTPRTVFSPRAESVRQSSSFSTRKTLTAGSKQVKE
RQSSSSEGDPSPPPVLPLMLDFSPEKAVTEIVEDKLKEAEVQNQLPEERQTKEILLVDIG
ADNSLPQTSECGSRPLIDLSNTPEVNKVIPLKPMFSEQIKLIDLSSPLITLSPDINKENL
DSPLLKF
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggaggagggaagagaaatggcattgccccgctccgggcgtgtggtggaagagaaaccg
agtgcttgcataggggtttcagactttcctcttctggctgatgaaaagttcgattttgac
ctttcgctctctccatcaagtggaagtgaagatgaagtctttattggatctttgggacac
aaagaaaaatgtatcgctgtcaatatcgaagcaaaaagtgctgaaaaaaagaaggtgccc
acttctgatgataaactcacctggagcccacttataggagataaatttgtggaaatcttc
aaagaagctcatttgctagcactgcaaatagaaagtggaaataagagtgaagagaataaa
gtaagccagtcagaaggaaatggaaatgagacttctgaacaatttgtggaggatttgaag
tcaaaaatgaaaatactgaaaagccatcatatagagaaaagtccccgggctgttaagagg
gagacatactgtgtgggagatagccctgcctgtatgctgctgccttcttttcagaaggaa
tcagataaacttctgtcaggtgacaagacacacattcttcatattccttcagacgaaagc
cctgttaaaattcaggcagctcctacagaaaccatcagttcgcctctgacgcaggtacag
aaaactaaggaaaaaaccaagaaagcaactggcaaactgctaatgccaaagctttcatct
actcttgggaaaagcagtatgctgactgtagaaaaggccaaaccaggaaaacagactagt
atttctacaaaaggagatttgaccagcgtgggatcatctgaagatctaatttcagataaa
tcaagtgctgcttcagatgtctttgagtcctcattaagtggcagttcctcagtgcaggac
aaaaaagtccttcctgcaccaaataagcctggccttgaatcctggtttaaaaaaacacat
ctgaaacttcctggtgttgccagtggtctcgcaaggaaaagtacttcatcttcttcatca
gtttccagtgtgagctcaaatctgaactcaagtttacccatttctcccataggaaaaaac
gggaaatcgaatgcaacttcaaaaactggtgtgagtggctctaaaccttcagctggtaca
aacagactatctctggccagaccaaccagagtttcatctctgcaggctgtcaatactgaa
agatccagcaagcaagcaagatcagctagcactcccaaaatatctagtgctgcaagcttg
gctaaatcttcagcttctgcactaacagtgccatctgagcctgaaggcagtggaattcag
aggctgaggtctctccccagtctgcagaagctatgtcaacaaaataaagatggaattaca
actaaaggaagcctgtgcccaaagcccagggctagacttctgtcagttcctgcaggtcaa
actcaggttccagtgaaagctggagatataacaccaaacaagtcagcaacaaaagcaaca
ccatcgcttggattaacattttgtggcaaagttggaagtgccatggcagtcagcacaccc
ctgaaagcttttgaagatgggatatttcagattccttgtgagaggcctgtttccatgact
cctggcagcttgaaacggtctgccatacctacacctgtccgtcgtatctcaggatttcca
gcagcaactcctaaaaccacaccaagaacagtattttctccacgtgctgagtctgttcgc
caaagttccagcttttctaccagaaagacactcacagctggttctaaacaggtaaaagag
agacagtcatcatcttcagaaggtgatccatctcctccccctgtgctgcctcttatgctt
gacttctcaccagaaaaagctgtgacagaaatagtagaagacaaattaaaagaggctgaa
gtacaaaatcagctgcctgaagagagacaaactaaggagatattactggtagatattgga
gcagataactctctcccacaaacttcagaatgcggaagcagacctctgattgacctttcc
aatactcctgaagtgaataaggttattcctctgaagcctatgttctcagagcagataaag
ttaattgatttgagctctcctcttatcactctgagtcctgatataaacaaagaaaatttg
gattctcctctgctgaagttctga

DBGET integrated database retrieval system