KEGG   Meleagris gallopavo (turkey): 100549522
Entry
100549522         CDS       T01523                                 

Gene name
ERCC6
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA excision repair protein ERCC-6
  KO
K10841  DNA excision repair protein ERCC-6
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    100549522 (ERCC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100549522 (ERCC6)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100549522 (ERCC6)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    100549522 (ERCC6)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      100549522 (ERCC6)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C TFIIF_beta SesA
Other DBs
NCBI-GeneID: 100549522
NCBI-ProteinID: XP_010712786
Ensembl: ENSMGAG00000008132
LinkDB
Position
8
AA seq 1497 aa
MPTENSHLPDSIQEQDPITTVSSICPHNAEESGTEQDNGICNSDQGNHFGVHSSDSKPST
SVAVPMEVPRRGQPLLHINRQQIQSVSYSAQAAELKGLGVDVYDQDVLEQGVLQQVDNAI
NEANKATKIADAEKEYQSVLDDLRSCTTSLKQIDKIIEQLSPQAANNKDINRKLDSVKRQ
KYNKEQQLKKIKAKQKRLQAVLGGTEILDKVNEIEFEDDEEPGPSSLGSMLMPVQETEWE
ELIRTGQMTPFGTKIPQKPERKTRRLMLNEASDFEKYLADQAKLSSERKKLSLHKRAKKK
AQAKNVQCVAPTSATKERRGKVLSKTDKRLKKHLKKLQKHALQVHSKAGIXKRKKNLETT
KLKPGQEDDSGESEYVPDEEQLEPAAVEEEEEQASSHAENDSDYELRNLSRKGKYLVRRD
SKDAENDADYFPSSEEEEHTVGKRKVKRWRDDGDEDYYKQRLRKWQRERLKDKERPVAEE
LSDESDTEFEEGFKVPGFLFKKLFKYQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIA
FLAGLSYSKIRTRGSNYRYQGLGPTVIVCPATVMHQWVKEFHTWWPPFRVAILHETGSYT
NKKVKLIREIASCHGILITSYSYIRLMQDNIHSYDWHYVILDEGHKIRNPNAAVTLACKQ
FRTPHRIILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQV
KLAYKCACVLRDAINPYLLRRMKADVKMSLSLPDKNEQVLFCRLTDEQRRVYQNFIDSKE
VYQILNGDMQVFSGLVALRKICNHPDLFSGGPKILKCLPDADLEEADQFGYWKRSGKMIV
VESLLKIWHKQGHRVLFFTQSRQMLQILEVFVRDRNYSYLRMDGTTTIASRQPLITRYNE
DKSIFIFLLTTRVGGIGVNLTGADRVIIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLL
TAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKSNDLYELFTLSSPDVSQGTETSAIFA
GTGSDVQVPKHQLKRKLERPADDDDTLKGGLHLKKSCSPKYSKSSSSHLTSHMANSSKAI
ETNKEAKGNLETFDQKNYAEDIAQTATNINSVNKSKQESLERADISLSQSLPGDAEPSEN
ATVTEEEHEVANENAEGDFSLLCSAAGCQEKQIGKTEDGQLDNNHYKCTSKTKHRVDMLS
HDSHKEKSKKKHHKDAKFEGERIPHLVKQKRYRKEDSEEKELDPKKNDDYVLEKLFKKTG
VHSVMKHDAIMEASSADYVLVEAEANRVAQDALRALKVSRQRCLGAASGVPTWTGVSGLS
GAPSGVKSRFGQKRNPMLLSSHSTCASPVKKCKDADTMKKENVKKNSTNGHFDGKLETGE
SSSSVLDSSSLLAKMRARNHLILPQRTGNEGDENLHQAPAPAPGSTEYDELLVDVRNFIA
FQARVDGEASTQEILQEFESKLPAAQSCVFRELLRNLCTFHRNPSGEGVWRLKPEFR
NT seq 4494 nt   +upstreamnt  +downstreamnt
atgccaacagaaaacagccacctaccagacagtattcaagaacaagaccccattactact
gtaagcagtatttgcccccataatgctgaagaatcaggaactgaacaagacaatggcatt
tgtaacagtgaccagggtaatcattttggagttcacagctctgacagcaagccatccact
tctgtggcagttcccatggaggtacccagaagaggacaaccccttctgcatatcaacagg
cagcagattcagtccgtttcatatagtgcacaggctgctgagctcaaaggtttaggagtc
gatgtgtatgaccaggatgtgttggagcaaggagttctccagcaagtagataatgcaatt
aatgaagctaacaaagcaacaaaaatagctgatgctgaaaaagagtatcagtcagtgctg
gatgacttaagatcatgtacaacatctctgaaacaaatagataaaattattgagcaactt
tcacctcaggctgccaacaacaaagatataaacagaaaactagattctgtaaaacggcaa
aaatacaacaaggaacaacagctaaagaagatcaaagcaaaacagaaacgtctccaagca
gttcttgggggaactgagattcttgataaagtaaatgaaattgaatttgaagatgatgaa
gagcctggtccatcatctcttggcagtatgcttatgcctgttcaggaaacagagtgggaa
gagcttattcgtacaggccagatgaccccgtttggaactaaaatacctcagaagccagag
aggaaaacacggcgactaatgctaaatgaagcatctgattttgaaaagtatttagcagac
caggctaagctgtcatctgagagaaagaagttatcccttcacaaaagagcgaagaagaaa
gcacaagccaaaaatgttcagtgcgtagctcccacatctgctacaaaggaaagaagaggt
aaagttctgtcaaaaacagataaacgtttaaaaaaacacttgaagaaacttcagaagcat
gcccttcaggttcattcaaaagcaggtattnctaaaagaaaaaaaaatcttgagactaca
aagctcaagcctggacaggaagacgatagtggagaatctgagtatgtacctgatgaggaa
caacttgagccagcagcagttgaagaggaggaagaacaggcatcttcacatgctgaaaat
gattctgattatgaactcaggaatttgtcaaggaagggaaaatacttggtgaggcgggat
tctaaagatgctgaaaacgacgctgactactttccaagctctgaggaggaagaacataca
gtagggaagcgcaaagtaaaaagatggagagatgatggagatgaagactattataaacag
aggctaaggaagtggcaaagagaacgtttgaaggacaaagaacgtcctgtggctgaagaa
ctttctgatgaaagcgacactgaatttgaagagggtttcaaagttccaggatttctcttc
aaaaagctttttaagtaccagcagacaggtgttaggtggctctgggaattgcactgccag
caggcaggagggattctgggagatgagatgggattgggcaagaccatccagataattgcc
ttcttggcaggtctgagctacagcaagatcaggactcgtggttcaaattacaggtaccag
ggattgggtccaacagtgattgtttgtccagctactgtgatgcatcagtgggtaaaagaa
ttccacacatggtggcctccatttagggttgccattctccatgaaactggttcttacacc
aacaaaaaggtgaaactaattcgagaaattgcttcatgccatggaattttaattacgtct
tattcatacattcgactgatgcaagataacatccacagctatgactggcattatgtgatt
ttggatgagggtcacaaaatccgaaatccaaatgctgcagtcacacttgcatgcaagcag
ttccgtacacctcatcgcatcatcttgtctggttcccctatgcaaaataacttgaaggag
ctctggtccctctttgactttgtattcccagggaaattgggaacactacctgtgttcatg
gagcaattttctgttccaataaccatgggaggatactccaatgcctctcctgtgcaggta
aaactagcatacaaatgtgcatgtgtgctacgggacgccataaatccttacctgctgcga
agaatgaaggctgatgttaaaatgagcctttcacttcctgataaaaatgaacaggtcctc
ttttgtcgtttgacagatgagcagcgtcgagtctatcaaaatttcatcgactctaaagaa
gtctaccagattctcaatggagacatgcaggttttctcaggactagtagctttgaggaag
atttgcaaccaccctgacctcttctctggtggtcccaagattttgaaatgcttgccagat
gctgatttggaggaagcagatcagtttggatattggaaacgttctggaaaaatgatagtg
gtagagtccttgctgaaaatatggcacaagcaaggtcacagagtgttgttttttactcag
tcaagacagatgctgcagatccttgaagtctttgtgagagacagaaactattcctacctc
aggatggatggcactacaacaatagcatccagacaaccccttataacaagatacaatgag
gacaaatccatatttatttttcttctgacaactcgtgttggtggtattggagttaatttg
actggtgctgaccgggttattatttatgatcctgactggaatcccagtacggacacacag
gcgcgtgaacgtgcttggagaataggtcaaaagaaacaagtgactgtgtacagacttctc
actgcaggtactattgaagagaagatataccacagacaaatcttcaagcaatttttaaca
aacagagtgctgaaagaccctaagcaaaggcgctttttcaaatccaatgatctttatgag
ctatttactctgagcagcccagatgtgtctcaggggacagaaacaagtgcaatttttgca
ggtactggttcagatgttcaagtccccaaacaccaattgaaacggaaacttgagaggcca
gctgatgatgatgacactttgaaaggtggtctccatcttaaaaaaagctgctcaccgaag
tacagcaagtcatctagttcccacttaaccagccacatggcaaattcttctaaagcaata
gagaccaacaaggaagccaaaggaaatttggaaactttcgatcaaaaaaactatgcagaa
gatattgcacaaactgctacaaacataaattcagtgaataaaagtaagcaagaaagcttg
gaaagagctgacatatctctgtcccaatcattgccaggtgatgcagagccttcagagaat
gccacggtgactgaagaagaacatgaagtggctaatgaaaatgctgagggagattttagc
cttctgtgtagtgcagctggctgtcaggaaaagcagattggtaaaacagaagatgggcaa
ttggataataatcattataaatgtacctcaaaaacaaagcacagagtggatatgctatca
catgacagccataaagagaagtctaagaagaaacatcacaaagatgccaagtttgaaggg
gagcgcattcctcacctggtgaaacaaaagcgctacaggaaggaggacagtgaagagaag
gagttggacccgaagaaaaatgatgattatgtcttggagaaactcttcaagaaaacagga
gtacacagtgtaatgaagcatgatgccattatggaagcttccagtgcagattatgtgctg
gtagaagcagaagcaaacagagtggcacaagatgcactaagagccttaaaagtctctcga
cagcgatgcttaggagctgcctctggtgtgccaacatggacaggtgtgagtggtctttca
ggtgcaccatcaggagtaaaaagtcggtttggtcaaaaaagaaaccctatgctgctttct
tcacattccacttgtgcatcacctgtgaaaaagtgcaaggatgcagatacaatgaagaaa
gaaaatgtgaagaagaatagtaccaatgggcactttgatggaaaattggaaactggagaa
tcatcatctagtgtattagattcttcatcattattagctaagatgagggcgagaaaccac
cttattttaccacaaaggacagggaatgagggagatgagaatcttcaccaagcaccagct
ccagccccaggttcaacagaatacgatgaattgctggtggatgtgcggaacttcattgca
ttccaggcccgtgtggatggtgaggctagtactcaggaaatactgcaggagtttgagtcc
aaactgcctgcagcacagtcttgtgtctttagagaactcctacgcaatctctgcaccttt
cataggaacccaagtggtgaaggtgtctggaggctgaagccagaattccgctga

DBGET integrated database retrieval system