KEGG   Meleagris gallopavo (turkey): 100549676
Entry
100549676         CDS       T01523                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04110  Cell cycle
mgp04114  Oocyte meiosis
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
mgp04540  Gap junction
mgp04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100549676 (CDK1)
   04114 Oocyte meiosis
    100549676 (CDK1)
   04115 p53 signaling pathway
    100549676 (CDK1)
   04218 Cellular senescence
    100549676 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100549676 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100549676 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100549676 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100549676 (CDK1)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100549676 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100549676 (CDK1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100549676 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100549676 (CDK1)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100549676 (CDK1)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100549676 (CDK1)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100549676 (CDK1)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100549676 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like Haspin_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 100549676
NCBI-ProteinID: XP_003207903
Ensembl: ENSMGAG00000002968
UniProt: G1MVE7
LinkDB
Position
8
AA seq 303 aa
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVCLQDVLMQDARLYLIFEFLSMDLKKYLDAIPSGQYLDRSRVKTYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNDVWPDVESLQDYKNT
FPKWKPGSLGTHVQNLDEDGLDLLSKMLIYDPAKRISGKMALKHPYFDDLDKSILPANLI
KKF
NT seq 912 nt   +upstreamnt  +downstreamnt
atggaggattacacaaagatagagaagattggggaaggtacctatggtgttgtgtataaa
gggcgccacaaaactacaggccaagtggttgcaatgaagaaaatacgtctagaaagtgag
gaggaaggtgttccaagtactgctatccgagaaatttctttattaaaagaactgcgtcat
cccaatatagtctgtcttcaggatgttcttatgcaggatgcaaggctatacctcattttt
gaattcctttccatggacctcaagaaatacttggatgctattccatctggccaatatttg
gatcgttcacgtgttaagacttacctgtatcagatcctgcaaggtatcgtcttctgccat
tcaagacgagttctgcacagagatttaaaacctcagaatcttctaatagatgacaaaggg
gtgattaaactggcagattttggattggctcgagcctttggaattccagtgcgagtatac
actcatgaagtagtgacactgtggtacaggtctccagaggttctgctaggatctgctcgt
tattccactcctgtagatatatggagcataggtaccatatttgcagagttagcaactaaa
aagccacttttccatggggactcagagattgaccagctcttcagaatcttcagagcatta
gggacacccaacaatgatgtgtggcctgacgtggaatccttgcaagactataaaaacact
ttcccaaaatggaaacctggcagcttgggaacacatgtccaaaacttagatgaggatgga
ctcgatctgttgtctaaaatgttaatttatgatcctgcaaaaagaatttctggcaaaatg
gccttgaagcacccatacttcgatgatttggacaaatctattcttcctgctaatctgatt
aagaaattctaa

DBGET integrated database retrieval system