KEGG   Meleagris gallopavo (turkey): 100549869
Entry
100549869         CDS       T01523                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22-like
  KO
K10136  TP53 apoptosis effector
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100549869
SSDB
Other DBs
NCBI-GeneID: 100549869
NCBI-ProteinID: XP_019469073
Ensembl: ENSMGAG00000012996
LinkDB
Position
2
AA seq 176 aa
MLCRLGTGAVVTTQRNPRTELDMVTPKQKTCSDLQLSALLPVTPFLFSFQGWGRAAAATY
LVGFVILVICFALAVIAFSIEILRFNFVRGIGGLLFVVAAFQIIGLVIYPVKFTEEIPLI
GANMFSWAYGFGWASTVVVIGCAFFFCCLPNWEDEVLGNIKPTYYYSSPDRAPYLN
NT seq 531 nt   +upstreamnt  +downstreamnt
atgttatgtagacttggaacgggagctgtggtgacaactcagcggaacccaaggactgag
ttggatatggttacccctaaacagaagacctgcagtgacctacagctcagtgcactgctg
cctgtgacacctttcctcttttcttttcaaggatgggggagagcagcagctgccacatac
ctcgttggctttgtgatcctggtcatctgtttcgccctcgcagtcatcgcattctcaatt
gaaatacttcgcttcaactttgtgcgaggaatcggaggcttgctttttgttgttgctgca
ttccaaatcatagggttggtcatctatccagtgaaattcacagaagaaattccactgatc
ggagctaatatgttcagctgggcctatggtttcggttgggccagcactgttgttgtgata
ggttgtgctttcttcttctgctgcctccccaattgggaagatgaagtcctgggaaacatc
aagccgacatactactactcctccccagatagagcaccatacttaaattga

KEGG   Meleagris gallopavo (turkey): 100550023
Entry
100550023         CDS       T01523                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22-like
  KO
K10136  TP53 apoptosis effector
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100550023
SSDB
Motif
Pfam: PMP22_Claudin L_HMGIC_fpl PalH DUF3488
Other DBs
NCBI-GeneID: 100550023
NCBI-ProteinID: XP_003204216
Ensembl: ENSMGAG00000012999
UniProt: G1NK02
LinkDB
Position
2
AA seq 189 aa
MVKYGLDYTRCRWILPLLLGIGVIFGIIALAGRGWLESQTLPYVHQASLWESCSRPSQGG
EWNCESLMGYAWGRAAAATYLVGFILLVICFALAIIAFAIDTLRFNFIRGIGGLLFVAAV
FSVMGLVIYPVKFSSEIEMTGINMFSWAYGFAWTTAIMEICLGFFFCCLPNYEDQILGNV
KPTYFYSSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atggtgaagtacggccttgactacactcgttgcagatggatcctacccctgctcctgggc
attggcgttatctttggcatcattgcactggcgggcaggggctggctggaatcacagacc
ttgccctatgtgcaccaagcgtcgctatgggagagttgcagcaggccttcacagggtggg
gaatggaactgcgagtctctcatgggttatgcttggggaagagctgcagctgccacatac
cttgttggcttcattctccttgtcatctgttttgctctggccatcatagcgtttgccatt
gatacacttcggttcaacttcataagagggattggaggcttgctttttgttgctgctgtg
ttctccgtcatgggcctggtcatttatccagtgaagttctccagtgaaattgaaatgacg
ggaatcaatatgttcagctgggcctatggctttgcctggaccactgccattatggaaata
tgcttgggatttttcttctgctgccttcctaactacgaagatcaaatcttgggtaatgtg
aagcccacatatttttactcttccccataa

DBGET integrated database retrieval system