KEGG   Meleagris gallopavo (turkey): 100549908
Entry
100549908         CDS       T01523                                 

Gene name
CCNH
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclin-H
  KO
K06634  cyclin H
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03022  Basal transcription factors
mgp03420  Nucleotide excision repair
mgp04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100549908 (CCNH)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100549908 (CCNH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100549908 (CCNH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mgp03021]
    100549908 (CCNH)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100549908 (CCNH)
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100549908 (CCNH)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100549908 (CCNH)
SSDB
Motif
Pfam: Cyclin_C_2 Cyclin_N Exo_endo_phos_2
Other DBs
NCBI-GeneID: 100549908
NCBI-ProteinID: XP_031413300
LinkDB
Position
Z
AA seq 456 aa
MGDFNHPDFCQDRGTVGDRQLTRFLESVEDNILVQALDRPTQGEALLDLELTSVEESIRE
VKTGGSLSCSDHVLVEFVIWRNAGLTKSKVRTLNFRRLNFQLLKELLNGISRETVLVGVG
TEQSWQLLKDTLLRIQETAVPQQKKWSRQVTSMASKDLGGSGPGLIRSASFPQVQQGDSF
LLEAHEELAICKYYEKRLLDFCAVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIML
TCAFLACKVDEFNVSSTQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRP
FEGILIDLKTRYPLLENPEVLRRTADDFLNRVALTDAYLLFTPSQIALAAIVSSASRAGI
NIESYLSECFMLKENRTFLTKILDGMRSMKNLIKKYELPRPEEVAALKQKLEKCHSPELS
LNANVKKRKIDEDGEYNSKKPKMDEEEWTDEDLADL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgggggatttcaaccatccagatttctgccaggatagaggcacggtgggtgacagacaa
ttgaccagatttctggagtctgttgaggataacatcctggtccaggcattagatagacca
acccagggtgaagccttactggacctggagctcaccagtgtggaggagagcattagagag
gttaagaccggaggcagcctaagctgcagtgatcatgtcctggtggagtttgtgatctgg
aggaatgcaggcctgacaaaaagcaaagtcaggactctgaacttcaggagattgaacttc
cagctgcttaaggaacttctgaatgggatctccagggaaactgtccttgtaggcgtagga
acagaacagagctggcagctccttaaagacacccttctgagaatacaagaaactgcagtt
ccccagcagaagaaatggagcagacaggtgaccagcatggccagtaaggacctgggcggc
tccgggccggggctcatcagatcggcgtctttcccccaggtacagcagggtgactctttc
ctgctggaggcccacgaggagctggcgatatgcaagtactacgagaagaggctgctggat
ttctgtgccgtcttcaagcctgccatgccgcggtctgtggtgggaacggcttgcatgtat
ttcaaacgtttttatctcaataactcagtgatggagtatcatcctcggataataatgcta
acgtgtgcatttttagcctgtaaagtagatgaatttaatgtgtccagcacacagtttgtt
ggtaaccttcgagaaagccctcttgggcaagaaaaagctcttgaacagatactggaatat
gaactactgctaattcagcagttgaacttccatcttattgtacacaatccatacaggcca
tttgagggaattctaattgatttgaagactcggtacccattgctggaaaaccctgaagtt
ttaaggagaacagctgatgatttcctcaatcgagtggctctgacagatgcatatctcctc
ttcactccctcacagatagctcttgctgctatagtatctagtgcttcaagagcaggaatt
aatatagaaagttatttatcagagtgttttatgctgaaagaaaacagaacattcttgacc
aaaatactggatggcatgagaagcatgaaaaatcttataaagaagtacgaacttccaaga
cctgaagaagttgcagctctaaaacagaagttagagaagtgtcacagtccagagctttca
cttaacgctaacgtgaagaagaggaaaattgatgaagatggtgaatataattcaaaaaag
cctaaaatggatgaggaagaatggactgatgaagaccttgcagacttgtga

DBGET integrated database retrieval system