KEGG   Meleagris gallopavo (turkey): 100550027
Entry
100550027         CDS       T01523                                 

Gene name
RRM2B
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2 B isoform X1
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00230  Purine metabolism
mgp00240  Pyrimidine metabolism
mgp00480  Glutathione metabolism
mgp00983  Drug metabolism - other enzymes
mgp01100  Metabolic pathways
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100550027 (RRM2B)
   00240 Pyrimidine metabolism
    100550027 (RRM2B)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100550027 (RRM2B)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100550027 (RRM2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100550027 (RRM2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100550027 (RRM2B)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     100550027 (RRM2B)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100550027 (RRM2B)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 100550027
NCBI-ProteinID: XP_003205263
Ensembl: ENSMGAG00000012288
LinkDB
Position
3
AA seq 353 aa
MEGEGLSTPGKGDAAACGEWSSSPSENGLKLHEEPLLRKNPRRFVIFPIQHPDIWKMYKQ
AQASFWTAEEVDLSKDLPHWNKLKPDEKYFISHILAFFAASDGIVNENLVARFSQEVQIP
EARCFYGFQILIENVHSEMYSLLIDTYIKDPEKRDFSFNAIETMPCVKKKADWALKWIED
RHSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLM
FHYLVNRPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLLMELG
FSKVFHAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETMDNVFTLDADF
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagggcgaagggttgagcaccccagggaagggtgatgcagctgcctgtggggagtgg
agctcctctccaagtgaaaatggcttgaaacttcacgaggaacctcttctcagaaaaaat
cctcgtcggtttgtcatcttccccatccagcacccggacatatggaaaatgtacaaacag
gcccaggcctccttttggacggcagaagaggttgatttatcaaaggaccttcctcactgg
aacaagctaaaaccagatgaaaagtactttatctctcatattctcgccttctttgcagcc
agtgatggaattgtaaatgagaatctggtggcacgctttagtcaggaggtgcagatccca
gaagctcgttgtttctatggcttccagattctcattgagaacgttcactcagagatgtac
agcttgcttatagacacttacatcaaagatcctgagaaaagggatttctcatttaatgct
attgaaacaatgccttgtgtcaagaaaaaagcagactgggctctgaagtggattgaagac
agacattccacttttggtgagagagtggttgcctttgctgcagttgaaggcatcttcttt
tcgggttcatttgctgctatattttggctgaagaagaggggcctgatgcctggattgact
ttctccaatgaacttatcagcagagatgagggtctacactgtgattttgcttgtctgatg
ttccattatttagtgaacagaccatcagaagagagggtccgggagatcattgttaatgct
gttgaaattgaacaggagtttctcacagaggcattacctgtaggtctgattggaatgaat
tgcactttgatgaagcagtatattgaatttgttgcagatcggttactaatggagcttgga
ttctcaaaggtttttcatgcagaaaatccttttgatttcatggagaatatttctctggaa
ggaaaaacaaatttctttgagaagcgggtttcggagtatcagcgttttgctgttatggca
gaaacaatggacaatgttttcactctggatgcagatttttga

KEGG   Meleagris gallopavo (turkey): 100550737
Entry
100550737         CDS       T01523                                 

Gene name
RRM2
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00230  Purine metabolism
mgp00240  Pyrimidine metabolism
mgp00480  Glutathione metabolism
mgp00983  Drug metabolism - other enzymes
mgp01100  Metabolic pathways
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100550737 (RRM2)
   00240 Pyrimidine metabolism
    100550737 (RRM2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100550737 (RRM2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100550737 (RRM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100550737 (RRM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100550737 (RRM2)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     100550737 (RRM2)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100550737 (RRM2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 100550737
NCBI-ProteinID: XP_010706221
Ensembl: ENSMGAG00000014009
LinkDB
Position
2
AA seq 343 aa
PGAVPSRAALCSLQVARGAEEEEEPLLRENPRRFVIFPIQYHDIWRMYKKAEASFWTAEE
VDLSKDLQHWESLKPEEKYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQI
AMENIHSEMYSLLIDTYIKDSKEREFLFNAIETLPCVKKKADWAIRWIGDKKATYGERVV
AFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLIRKPSE
ERVKEIIMNAVLIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFRKIYKVENP
FDFMENISLEGKTNFFEKRVGEYQRMGVMSKPTDNSFTLDAEF
NT seq 1032 nt   +upstreamnt  +downstreamnt
cccggcgcggtgccgtcccgagccgctctgtgctccctgcaggtggcgcggggcgcggag
gaggaggaggaaccgctgctgcgggagaacccccggaggttcgtcattttccccatccag
taccatgacatctggcggatgtacaagaaggctgaggcttccttttggacggcagaggag
gtggatctgtccaaagatctgcagcactgggagtccctgaagcccgaggagaagtacttc
atctctcacgtccttgccttctttgctgccagcgatggcatcgtgaacgagaacttggtg
gagcggttcagtcaagaagtgcaaatcacagaagctcgttgtttctatggcttccagatt
gccatggaaaatatacattcagaaatgtacagtcttctcattgacacgtacattaaagat
tctaaagagagggaattcctttttaacgctattgaaacattaccatgtgttaagaagaag
gctgactgggccatacgctggattggggacaagaaagcaacatatggagaacgtgtagta
gcatttgcagcagtggaaggaatcttcttttctggctcttttgcatcaattttttggctg
aagaaaagaggcttaatgcctggactcactttttctaacgagctcatcagtagagatgag
ggtttgcactgtgattttgcctgccttatgttcaagcacttgatacgcaaaccatcggag
gaaagagtaaaggaaatcatcatgaatgcagttctcatagaacaggaattcttgacggag
gcactgcctgttaagttgattggcatgaactgcactttaatgaaacagtacatagagttc
gtagcagaccggctgatgttggaactgggatttagaaagatatacaaggtggagaatcct
tttgatttcatggagaacatctctctggaaggcaagaccaatttctttgagaagcgagta
ggtgaatatcagaggatgggagtcatgtcaaagcccacagacaactctttcaccctggat
gcagaattttaa

DBGET integrated database retrieval system