KEGG   Meleagris gallopavo (turkey): 100550092Help
Entry
100550092         CDS       T01523                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00590  Arachidonic acid metabolism
mgp01100  Metabolic pathways
mgp04370  VEGF signaling pathway
mgp04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100550092 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100550092 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100550092 (PTGS2)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100550092 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 100550092
NCBI-ProteinID: XP_010713838
Ensembl: ENSMGAG00000001287
LinkDB All DBs
Position
10
AA seq 571 aa AA seqDB search
MTTGFDRYECDCTRTGYYGENCTTPEFFTWLKLTLKPTPNTVHYILTHFKGVWNIINNIS
FLRDTIMRYVLTSRSHLIDSPPTYNSDYNYKSWEAYSNLSYYTRSLPPVGHDCPTPMGVK
GKKELPDSKLIVEKFLLRRKFIPDPQGTNVMFTFFAQHFTHQFFKTDHKKGPGFTKAFGH
GVDLNHIYGETLERQLKLRLHKDGKLKYQMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDEQLFQTTRLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEY
RKRFMLKPFKSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEIG
APFSLKGLMGNTICSPEYWKPSTFGGKVGFEIINTASLQKLICNNVKGCPFTAFHVLNPE
PTEATINVSTSNTAMEDINPTLLLKERSAEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggctttgaccggtatgaatgtgactgcacgaggacaggctattatggggaa
aactgtacgacaccggaattcttcacgtggctgaaactaacattgaaacctacaccaaat
actgtccactacattctcacccacttcaaaggagtctggaacatcatcaacaacatttcc
ttcttacgagatactattatgagatacgtgttgacatcaagatcacacttgattgacagc
ccaccaacatacaatagtgactataattacaaatcctgggaagcttattctaatctttcc
tattacacaagaagccttccaccagtaggacatgactgtccaacaccgatgggtgttaaa
ggtaagaaagagctcccagattcaaagctgattgtggagaaattcttgctgcggagaaaa
tttattcctgacccacaaggcacaaatgtgatgttcacattctttgcccagcacttcact
catcagttctttaagacagaccataagaaaggacctggcttcactaaagcttttggccat
ggggttgacttgaaccacatttatggagagactctggagaggcaacttaaattgagactt
cacaaggatggaaaactaaagtaccagatgattgatggagaaatgtatccaccaacagta
aaggacactcaagcagagatgatctaccctcctcacgttcctgagcacctgcagttttct
gttgggcaggaggtgtttggcttggtcccaggcctaatgatgtatgcaacgatatggctg
agagaacacaatagagtctgtgacatcttgaaacaggagcatccagagtgggatgatgag
cagctatttcagactacaagactcatattgataggagaaacgatcaagatagttattgaa
gattatgtgcaacacttgagtggctaccacttcaaactgaagtttgatcctgagcttctg
ttcaaccagcgttttcaataccagaaccgaattgcagctgaattcaatactttgtaccac
tggcacccacttctgcctgacacttttcagatacatgaccaggagtacactttccagcag
ttcctctacaacaactccataatgctggaacatggcctttcccatatggtgaaatctttc
tccaagcaaagtgctggcagggttgctggtggcaaaaatgttccagctgcagtacagaaa
gtagcaaaggcttcaattgaccaaagcagacaaatgagataccagtccttgaatgagtac
aggaaacgcttcatgttgaaaccattcaaatcatttgaagaacttacaggagaaaaagaa
atggctgctgaactagaagagctttacggagacatagatgctatggaactgtatccaggc
cttcttgtagaaaagccaagaccaggtgccatctttggtgaaacaatggtagaaattggc
gcaccgttctctctgaaaggactgatgggaaatacaatatgctcccctgagtattggaag
ccaagcacctttggtggaaaagtggggtttgaaataatcaatactgcctccctacagaag
ctcatctgcaacaatgtgaaaggctgtcctttcactgctttccatgtcttaaatcctgaa
cccacagaggcaactattaatgttagtacctcaaacacagcaatggaagatatcaacccc
acactactactgaaagagcgatctgctgagttgtaa

DBGET integrated database retrieval system