KEGG   Meleagris gallopavo (turkey): 100550112Help
Entry
100550112         CDS       T01523                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03410  Base excision repair
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100550112 (LIG1)
   03410 Base excision repair
    100550112 (LIG1)
   03420 Nucleotide excision repair
    100550112 (LIG1)
   03430 Mismatch repair
    100550112 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100550112 (LIG1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100550112 (LIG1)
Enzymes [BR:mgp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100550112 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100550112 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100550112 (LIG1)
DNA replication proteins [BR:mgp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100550112 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100550112 (LIG1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100550112 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100550112 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     100550112 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DDR
Motif
Other DBs
NCBI-GeneID: 100550112
NCBI-ProteinID: XP_019468290
Ensembl: ENSMGAG00000010919
LinkDB All DBs
Position
1
AA seq 777 aa AA seqDB search
MQRRITSFFAPPRAADGVVPARVQKLERSPPEETLQEHRDPDGSADPTSPGSSSAPVPPA
SPRAPCCTPSQQQPGDTDGDSDGDRDSAPPASKRCRQSPGDQDKGPPRPHKAPASNSCIP
VEPSQYDPSRSGYHPVQDACWGHGRSVPYLAVARTFERIEEASSRLKIIEILTNFLRSVV
ALSPSELLPCLLLCLNRPGAASEGLELGIGETLLTRALAQATGRQLAQIRSEAQDKGDLG
LVAESSRCTQRTVVPPAPLSASGVLGKLREMAAMSGNASASKKIDIVKGLFVACRHSEAR
YLVRSLSGKLRIGLAEQSVLTALAHAVALTPPGQERPLAVVDAGQSMAPDARRTWLEEQS
RILKQTFCELPDYTAIVPVLLEHGLEQLPKHCGITPGVPLKPMLAQPARCVSELLKRFEE
AAFTCEYKYDGERTQIHVLDSGAVFIYSRNQENTTAKYPDLVERIPKMLKPGVRSCILDA
EAVAWDKVTKQLQPFQVLMTRKRKDVDAAAIKVQVCVYAFDLLYLNGEPLVREPLATRRR
LLRESFEEVEGEFLFATSMDTRSADEVSDFLDKAIKASCEGLMVKTLEVEATYEIAKRSH
KWLKLKKDYLDGLGDTLDLVVIGAYLGKGKRAGIYGGFLLACYDEESEEYQSICKIGTGF
TEESLEKHYNFLKEHVLTQPRPYYRWDNAVAPDRWLAAVQVWEVKCGDLSISPVYRAAVG
LVDEDKGISLRFPRFLRVRGDKKPEEATSSTQVAELYKKQQQIQNQQQAEKGDEEFY
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggcggatcacgtcttttttcgccccccccagggccgcagatggcgtcgtccca
gcgcgtgtgcagaagttggaacggagcccccccgaagagaccctccaggaacatcgggac
cccgatgggagcgcggatcccacatcccctggcagcagctctgcccctgtaccccccgcg
tcccctcgtgccccctgctgtaccccctcccaacagcagccaggggacacggatggagac
agtgatggggacagggacagtgccccccccgcatccaagcgctgccgtcagtcgcccggc
gaccaggacaagggacctccccgtccccacaaagctccagcctccaacagctgtatacca
gtggagccatcccagtatgaccccagcaggagtgggtaccacccagtgcaggatgcgtgc
tgggggcatgggcgcagtgtcccctacctggcggtggctcgcacctttgagcgcatcgag
gaagcctcatcccgactgaagatcattgagatcctcaccaacttcctgcgctccgtggtg
gccctgtccccctccgagctgctcccctgtcttcttctgtgcctcaaccgtcccggagcc
gcctctgaggggctggagctgggcatcggcgagaccctgctcacccgtgccctcgcccag
gccactggccgccagctggctcagatccgcagtgaagcgcaggacaaaggggatttgggg
ctggtggccgaaagcagccgctgcacccaacgcacggtggtgccaccggccccgctgagt
gccagcggtgtcctcggcaagctgcgggagatggccgccatgtcaggcaacgcgtctgct
agcaagaagattgacatcgtcaaggggctgtttgttgcctgccggcactcggaggcacga
tacctcgtccggtcgctcagtgggaagctgcgcattgggctggccgagcagtcggtgctc
accgcgctggcacacgccgttgctctcacgccgccagggcaagagcggccgctggctgtg
gtggatgctgggcagagcatggcacctgatgcacgcagaacttggttggaggagcagagc
cgcatcctcaagcagactttctgtgagctgccagactacactgccattgtcccagtgctg
ctggagcacggcctggagcagctccccaagcactgcggcatcactccaggtgttcccttg
aagcccatgctggcccaacctgctcgctgcgtcagtgagctgctgaagcgctttgaggag
gctgcattcacctgcgagtacaaatatgatggggaacgaacccagatccatgtcctggat
agcggggccgtcttcatctacagccgcaaccaggagaacacaacagccaaataccctgac
ctcgtcgagcgcatccccaagatgctgaagcccggcgtgcgctcgtgcatcctggatgca
gaagcggtggcctgggacaaggtcaccaagcagctgcagcccttccaggtgctgatgacg
aggaagaggaaggatgtggatgccgctgccattaaggtgcaagtgtgtgtctatgccttt
gatctgctatacctcaatggggagccactggtgcgggagcccttggccacgcgacgtcgg
ttgttgcgagagtcattcgaggaagtggagggcgaattcctctttgccacctcgatggac
acccgcagtgctgatgaggtctctgatttcctggacaaagccatcaaggcctcttgtgag
ggcctcatggtgaagacactggaggtggaggccacgtacgagattgccaagcggtcccac
aagtggctgaagctgaagaaggactacctcgatggccttggggacacgctggacctcgtt
gtcataggtgcctacctgggcaagggcaagcgtgcaggcatctatgggggcttcctcctg
gcctgctatgatgaggagagtgaggagtaccaaagcatctgcaagataggcactggtttc
accgaggagagcttggagaaacactacaacttcctcaaggaacacgtgttgactcaaccg
cgtccctattaccgctgggacaacgcagtggctccggaccgttggctggcagctgtgcag
gtctgggaggtgaaatgtggggacctgtccatttcccctgtctacagggcagctgtgggg
ctggtggatgaggacaagggcatctcgctgcgcttcccgcggttcctgcgtgtgcgcggg
gacaagaaacctgaggaggccaccagcagcacgcaggtggccgagctctacaagaagcag
cagcagatccagaaccagcagcaggcagagaaaggggacgaggagttctattga

DBGET integrated database retrieval system