KEGG   Meleagris gallopavo (turkey): 100550131
Entry
100550131         CDS       T01523                                 

Gene name
GTF2H1
Definition
(RefSeq) general transcription factor IIH subunit 1
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03022  Basal transcription factors
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100550131 (GTF2H1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100550131 (GTF2H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mgp03021]
    100550131 (GTF2H1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100550131 (GTF2H1)
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100550131 (GTF2H1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100550131 (GTF2H1)
SSDB
Motif
Pfam: PH_TFIIH BSD
Other DBs
NCBI-GeneID: 100550131
NCBI-ProteinID: XP_010709372
UniProt: G1N626
LinkDB
Position
5
AA seq 548 aa
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTVSHMYADIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLSLNAGDNSAAPSKQDVGISAAFLADVRPQTDGC
NGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEREFWTRFFQSHYFHRDRLNTGSKD
LFAECAKLDEKGLKAMVSQGVKNPMIDLTALEDRTLDEGYGVAPMASTSNASKTARESSN
AAIIKRFNHHSAMVLAAGLRKQEAQNDHYSETSSTDGNSRDSDFFQPPMKKVKLQESIEY
EDLAMNNSTKTIALNLKKSDRYYHGPTPIQSQQYATSQDIINSFHSIRQEMEAYVPNLTQ
VLSSGDATSTIAVLSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFP
VNTPFLEEKVVKMRSNLERFQLTKLCPFQEKIRRQYLSTNLISHIEEMLQTAYNKFHTWQ
SRRMLKKT
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggcaacgtcatcagaagaagtgttactgattgtaaagaaggtccgccagaagaagcag
gatggagctctctaccttatggctgagaggatagcgtgggcacccgaaggcaaagaccgc
ttcacagtcagccacatgtatgcagacataaaatgccagaaaatcagtccagaaggtaaa
gctaaaattcagcttcagctagtattgcatgcaggggacacaaccaactttcacttctcc
aacgaaagcacagcagtgaaggagcgagatgcggtaaaggaccttcttcaacaactcttg
cccaaattcaagaggaaagctaataaagaacttgaggagaagaacagaatgctgcaagaa
gatcctgttttgtttcagctctataaagaccttgttgtgagccaagtaatcagtgctgaa
gaattctgggccaaccgtttaagcctgaatgcaggggataattctgcagcacctagtaag
caggatgtgggcatctctgcagcatttctggctgacgtacgacctcaaacagatggctgc
aatggtctgaggtacaatttgacttcagatatcattgaatccatatttcgaacatatcct
gcagtaaaaatgaaatatgcagaaaatgttccacataacatgacagaaagggaattctgg
acacgattttttcagtctcattatttccaccgggacagactgaatacaggctcaaaagac
ctctttgctgaatgtgccaaactggatgagaaagggttaaaagcaatggtatctcaagga
gtgaaaaaccctatgatagatttaacagctttggaagacagaacgttagatgaaggctat
ggtgttgctcctatggcctctacatcaaatgcctcaaaaactgctagagaaagtagcaat
gctgccattataaaacgctttaatcatcatagtgccatggtccttgcagctggcctcaga
aaacaagaagcacaaaatgaccattacagtgagaccagcagtacggatggaaactccagg
gattcagatttctttcaaccaccaatgaaaaaggtgaaactacaggaatccattgaatat
gaagatttagcaatgaataatagcactaaaactattgcactaaatttaaagaaatctgac
aggtattatcatggtccaactccaattcaatcacagcaatatgcaaccagtcaggatata
attaattcttttcatagtattaggcaagaaatggaagcatatgtacccaatctaactcag
gttctttcaagtggtgatgctactagcactattgcagtcctgtcacctggaggagcactt
atgcagggtggaacacagcaagccataaaccagatggtgccaaatgacattcagtctgaa
ttaaaacatttgtatgtggcagtaggggaactgctaagacacttctggtcctgctttcct
gttaatacgccattcctagaagaaaaggttgtgaaaatgaggagcaacttggaaagattt
cagcttacaaagctctgcccattccaagaaaagattcggagacagtatttaagcacaaat
ttgataagtcatatagaagagatgctgcagacagcctacaataagttccacacgtggcag
tcccggcgtatgctgaagaagacgtga

DBGET integrated database retrieval system