KEGG   Meleagris gallopavo (turkey): 100550139
Entry
100550139         CDS       T01523                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 isoform X1
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04060  Cytokine-cytokine receptor interaction
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04217  Necroptosis
mgp05164  Influenza A
mgp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100550139 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100550139 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100550139 (FAS)
   04217 Necroptosis
    100550139 (FAS)
   04115 p53 signaling pathway
    100550139 (FAS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100550139 (FAS)
   05168 Herpes simplex virus 1 infection
    100550139 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mgp04050]
    100550139 (FAS)
   04090 CD molecules [BR:mgp04090]
    100550139 (FAS)
Cytokine receptors [BR:mgp04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100550139 (FAS)
CD molecules [BR:mgp04090]
 Proteins
  100550139 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 stn_TNFRSF12A DUF2627 SCF SKG6
Other DBs
NCBI-GeneID: 100550139
NCBI-ProteinID: XP_003208070
LinkDB
Position
8
AA seq 364 aa
MARGLFHLLLVVALVMETHCKNDTEVPIHIAHNKSITRKRNIAKREIICTEEEYILNDQC
CMKCRRGHVKSTECPNTQAHCVPCKSGEEYMDHTNDLDKCMRCRSCDTALGWKVVKNCTP
TENAECSCAKNHYCKSPQCEYCELCTVCENGLVEKECTSTTDTVCRMQEAGMPPWGTALI
VLFVVALAVAAGLILYRKRKQKNFITQGNTGTGRDSSSETFTLISIDDDLSRHIPDIVRE
MTLDEVKTFVRHHQLSEPTIDEIIQDNFNNASEQKIKLFQKWHQRHGIRGAYETLISSLR
DLKMRAVADKIEEKLKAAVSSHQERRESYNDKTGQSNSCSQEGGKSYHDNAEISKTYPES
LEET
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggctcggggactcttccacctgctcctcgtggttgcgttagttatggaaacacattgc
aaaaatgatacagaagttcccatacacatagcacacaataaatctattacaaggaagaga
aacatcgctaagcgagaaattatctgtacagaggaagagtacattttaaatgatcagtgc
tgtatgaaatgtagacgtggtcatgtcaaaagtactgagtgcccaaacactcaagcacat
tgtgtaccatgcaaatctggagaggagtacatggatcataccaatgatttggacaagtgt
atgagatgtcgttcatgtgacacagcacttggttggaaggttgtaaagaactgtactcca
acagagaatgcagaatgctcctgtgcaaagaaccattattgcaagtctcctcaatgtgaa
tactgcgagttatgtaccgtatgtgaaaatggcctagttgaaaaggaatgtacttcaact
acagacactgtgtgcagaatgcaagaagcaggaatgccaccttggggtaccgcacttatt
gtcttatttgtggtagcattagcagttgcagcaggattaatactctaccgtaagagaaaa
cagaagaattttattacccaaggtaacacaggcactggaagagacagttcttctgagact
tttacactcatatctatagatgatgacctgagccgccatatccctgacatcgtgagggag
atgacactagatgaggtcaagacttttgttcgtcatcaccagctttcagaacctaccata
gatgaaattatccaggataacttcaataacgcatctgaacagaagattaagctctttcag
aaatggcaccaaaggcatgggataagaggagcctacgaaaccctaataagcagcctgaga
gatttaaaaatgcgtgcagtagctgataaaattgaggaaaaactgaaggcagctgtttca
agccaccaggaaaggagagagtcttataatgataaaactgggcaaagcaattcctgcagt
caggaaggtggaaaatcttatcatgataatgctgaaataagtaaaacttaccctgagagt
ttggaagagacatag

DBGET integrated database retrieval system