KEGG   Meleagris gallopavo (turkey): 100550141
Entry
100550141         CDS       T01523                                 

Gene name
GORAB
Definition
(RefSeq) RAB6-interacting golgin
  KO
K19748  RAB6-interacting golgin
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100550141 (GORAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100550141 (GORAB)
Membrane trafficking [BR:mgp04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    100550141 (GORAB)
SSDB
Motif
Pfam: Transcrip_act Redoxin
Other DBs
NCBI-GeneID: 100550141
NCBI-ProteinID: XP_031410829
Ensembl: ENSMGAG00000004043
LinkDB
Position
10
AA seq 375 aa
PIYSLCLFLRPAFNSLFPAHPLIDLSEPPEQPRRPHPANKNWKQLQREKALQQQCQKLGL
QGGAASVPPEQLLSAPKHKPCNPQQPVPAPHRSSADQRQHDGKDQQKEARPAGPCDGSDS
ARNLTPKTSSKVEKKKVELQEKSRWEILQQEQRLIEEKNKRKKALLAKAIAERSKRTQAE
TVKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRYDKAESEYVAAKLDLQHK
TEIKEHLTEHLCTIIQQNELRKARKLEELMQQLEVEADEENLELEIEVERMLQQQEAEAG
RQASQSHNRAGTAKENSAPTVTTKESEHANHAAASPALSEQLVSENSGTKSLSDMDNQTQ
AVNVTPGDSPACSAT
NT seq 1128 nt   +upstreamnt  +downstreamnt
ccaatttacagtctgtgtttgtttttaaggcctgcttttaattctctttttcccgctcat
ccattgatagatttatctgagcccccagagcagccgcgtcgtccccaccctgcgaataag
aattggaagcaactgcagcgagaaaaagctctccagcagcaatgccagaagctgggactg
cagggtggagcagcctctgttcctcctgagcagttgctgtctgcaccaaaacataaacct
tgtaatcctcagcagcccgtgccagcaccacatcgttcttcagcagatcaaaggcaacat
gacggcaaagatcagcagaaggaggcgaggccagcaggtccttgtgatggcagtgacagt
gcccggaacctcactccaaagacgagcagcaaagtggagaaaaagaaagtggaattgcag
gaaaaatcacggtgggagatcctccagcaagagcaacggctgatagaagagaagaataaa
cgcaagaaggcacttctggccaaggctattgctgagagatccaaaagaactcaagctgaa
acagtgaagctaaaaaggattcagaaggagttacaagctttagatgacatggtgtctgct
gacatcggcatcctgcggaaccgcattgatcaagccagcttggactactcctatgcccgg
aagcggtatgataaggctgagtcggagtacgtggcagccaagctggacctccaacacaag
acagagatcaaggagcacctcacagagcacctgtgcacgatcatacagcagaacgagctc
cgcaaggccaggaagctggaggagttaatgcagcagctggaagtggaggcagatgaggaa
aatctggaacttgagatagaggtggagcggatgctgcagcagcaggaggcagaagcaggg
agacaagccagccagtcacacaatcgtgctgggacagctaaagaaaactcagctcccact
gttacaacaaaggagagtgagcatgctaaccacgctgctgcttctcctgctctctctgaa
cagttggtgtctgaaaactccggtaccaaatccctctctgatatggacaaccagactcag
gcagtaaatgtgactcctggagactccccagcttgctctgctacatga

DBGET integrated database retrieval system