KEGG   Meleagris gallopavo (turkey): 100550410
Entry
100550410         CDS       T01523                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04370  VEGF signaling pathway
mgp05164  Influenza A
mgp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100550410 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100550410 (CASP9)
   04115 p53 signaling pathway
    100550410 (CASP9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100550410 (CASP9)
   05168 Herpes simplex virus 1 infection
    100550410 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgp01009]
    100550410 (CASP9)
   01002 Peptidases and inhibitors [BR:mgp01002]
    100550410 (CASP9)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100550410 (CASP9)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100550410 (CASP9)
Peptidases and inhibitors [BR:mgp01002]
 Cysteine peptidases
  Family C14: caspase family
   100550410 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 100550410
NCBI-ProteinID: XP_010721334
LinkDB
Position
23
AA seq 400 aa
MTPLPADSFLAQEASLSLVPAFPPLQSAGTRREQARQLVIDLETRGKQAFPIFLSILRET
GHDDLADMLDEGCGSPISPPVDLRPVQLELPGERRDKSVSTAERLSIPVQAESQRFQMPP
APAHGSAVDKSDHRLVYQLRADPCGHCLIFNNVNFSRDSDLSARAGSDIDCEKLEKRFKS
LCFHVRTLRNLKAQEIDLELRKLARLDHSTLDCCLVVILSHGCQTSHIQFPGGIYGTDGK
TIPIEKIVNYFNGSQCPSLRGKPKLFFIQACGGEQKDQGFEVGCESPQDETCRGSVESDA
IPFQAPSGSVDEPDAVASLPTPGDILVSYSTFPGFVSWRDKVSGSWYVETLDDVLEHYAR
SEDLLTMLLRVSDIVSTKGKYKQIPGCFNFLRKKFFFLCK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgaccccattgcctgctgacagtttcctggctcaggaagcatcactgagccttgtccct
gccttccctcctctgcagagtgctggcacccgaagggaacaagcacgacagctggtcata
gacctggagacccgcgggaagcaggccttcccaatattcctctccatcctgagggaaact
gggcatgatgacctggctgacatgctggatgaggggtgtggaagccccatctccccacct
gtggacctgaggcctgtgcagctggagctgcccggagaaaggcgtgacaaaagtgtgagc
actgcagaacgcttgtccatcccagtccaagctgagagtcagcgatttcagatgcctcca
gcaccagcccatggttcagctgttgacaagagtgaccacagactggtgtaccagctgcga
gcagacccttgtgggcactgcctgatcttcaacaatgtcaacttcagcagagattctgat
ctgtcagctcgggctggctctgacatagactgtgagaagctggagaaacgtttcaagtcc
ttgtgcttccacgtccggaccttgaggaatctcaaagctcaggaaattgatctggagctg
cggaagctggcacggctcgaccacagcaccctggactgctgcctcgtggtcatcctctcc
catggctgccagacaagccatattcagtttcccggagggatttacggaacagatggcaaa
accattccaattgaaaagattgtgaactatttcaatgggtcccagtgcccaagtttgaga
ggaaaacccaaactcttcttcatccaggcctgtggaggagaacaaaaggaccagggattt
gaggtgggttgtgaatcaccccaagatgaaacttgccgaggttccgtagagtcggatgcg
attcctttccaggctccatcagggagtgtggatgagccagatgctgttgccagtttgccc
actcctggtgacatcttggtgtcctattcaacttttccaggttttgtgtcctggagggac
aaggtgagtggctcgtggtatgtggaaaccctggatgatgtgctggaacattatgcccgt
tctgaagacctgctaaccatgttgctccgggtgtcagacatcgtatccaccaaggggaag
tacaagcagatcccaggctgtttcaactttctacgtaaaaaattcttcttcctgtgcaaa
tga

DBGET integrated database retrieval system