KEGG   Meleagris gallopavo (turkey): 100550557Help
Entry
100550557         CDS       T01523                                 

Definition
(RefSeq) caskin-1-like
  KO
K21952  CASK-interacting protein
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100550557
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100550557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Caskin1-CID Ank_3 SH3_2 SH3_1 SH3_9 SGBP_B_XBD
Motif
Other DBs
NCBI-GeneID: 100550557
NCBI-ProteinID: XP_019476163
Ensembl: ENSMGAG00000006117
LinkDB All DBs
Position
16
AA seq 521 aa AA seqDB search
MSAVGLSAGGELLGSAKRVNVNFQDTDGFSALHHAALNGNTELISLLLEAQAAVDIKDNK
GMRPLHYAAWQGKKEPMKMVLKAGSSVNIPSDEGQIPLHLAAQHGHYDVSEMLLQHQSNP
CIMDNSGKTPLDLACEFGRVGVVQLLLNSNMCAALLEPKPGDTTDPNGTSPLHLAAKNGH
IDIIRLLLQAGIDINRQTKAGTALHEAALCGKTDVVRLLLDSGINAHVRNTYNQTALDIV
NQFTTSQASKEIKQMLRDASAALQVRAVKDYCNNYDLTSLNVKAGDVITVLEQHADGRWK
GCIHDNRTGNDRVGYFPSSLVEAISKRTGSWETVTIPQQYQKIPLPAYGAAVLNGDASSH
PFHSLPPPPPPPPHSHQTLFSSFGYHRLSPSSADEPRYGQGSRGADMSPSHLSPSQGGSA
APAPIEEIWVLRKPFTGGDRSSLGSTGSVASARSSGSGQSTGSGAHALHAGSEGVKLLAT
VLSQKASAQDAAVGDGPAKAQDIPAGACRRPGSTASTAVEN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgtggggctgtcagcaggtggtgagctccttggatcagcaaagagagtcaac
gtcaatttccaggacaccgatgggttctctgccctgcaccatgcagctctcaatgggaac
acagagctcatctcgctgctgctggaggcacaggctgcagtggacatcaaggataacaaa
ggcatgcggcccttgcactatgcggcctggcaaggcaagaaggagcccatgaagatggtg
ctgaaggcaggctcctctgtgaacatcccatcagatgagggacagatccccctgcacctg
gcggcacagcacgggcactacgacgtgtctgaaatgctcctgcagcaccagtccaacccc
tgcatcatggacaattcaggcaagacgcccctggacttggcatgcgagtttggccgggtt
ggggtggtccaactgctcctgaacagcaacatgtgtgcggcgctgctggagcctaagcca
ggggacaccaccgaccccaatggcaccagccctctgcaccttgcagccaagaatggacac
atcgacatcatccggctcctgctgcaagctggcattgacatcaaccggcagaccaaggcg
ggcacagcactgcacgaggcagccctgtgtggcaagacggacgtggtgcggctcctgctg
gatagtggaattaatgcccacgttcggaacacgtacaaccagacggctctggacattgtc
aaccagttcaccaccagccaggccagcaaggagatcaagcagatgctgcgggatgcctca
gctgcacttcaggtgcgggctgtcaaggactattgcaacaactacgacctgaccagcctc
aatgtgaaagctggagacgtcatcactgtgctggagcagcatgcagacgggcgctggaag
ggctgcatccatgacaatcggaccggcaacgaccgcgtgggctacttcccctccagcctc
gtggaagccataagcaagcgaacaggttcatgggagactgtaacaatcccccaacagtac
caaaagatcccgctcccggcttacggggctgctgtgctaaacggtgacgcctcgtcccat
ccgttccattccctgcctccacctccacctccaccaccacattcccatcagactcttttc
agttcctttggctatcacaggctctcccctagcagtgccgacgagccgcgttacggacaa
gggtcccgcggggctgacatgagcccatcccacctttcaccatcgcagggtggatcggct
gcacctgcacccatcgaggagatctgggtgctgcggaaacctttcacaggtggcgaccgc
agcagcctgggtagcacgggcagcgtggcctcagcccgcagctccgggagtgggcagagc
acgggcagcggggcgcacgccctgcatgctggctccgagggcgtcaagctgctggcaacg
gtcctttcccagaaggcttctgcgcaagatgctgccgtgggcgatgggccggccaaggcg
caggacatccccgcaggtgcgtgccgccggcccggctccactgcgtccacggcagtggaa
aattag

DBGET integrated database retrieval system