KEGG   Meleagris gallopavo (turkey): 100550687Help
Entry
100550687         CDS       T01523                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04068  FoxO signaling pathway
mgp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100550687 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100550687 (SOD2)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100550687 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100550687
NCBI-ProteinID: XP_010705429
Ensembl: ENSMGAG00000012503
LinkDB All DBs
Position
2
AA seq 224 aa AA seqDB search
MLCRLASAGRSRAALVAPLGCSVARQKHTLPDLPYDYGALEPHISAEIMQLHHSKHHATY
VNNLNVTEEKYKEALAKGDVTAQVSLQPALKFNGGGHINHTIFWTNLSPSGGGEPKGELM
EAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIP
LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSSRYASCKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgcctggcctcggcgggcagaagcagggctgcgctggtagcaccgttaggg
tgctctgtcgcaaggcagaagcacactcttcctgacctgccctacgactatggcgcgctg
gagccccacatcagtgcagagatcatgcagctgcaccacagcaaacaccacgccacctac
gtgaacaacctgaacgttacggaggagaaatacaaagaggcgctagcaaaaggtgatgtt
acagctcaggtgtcgcttcagcctgcactgaaattcaatggtgggggtcatatcaatcat
accatcttctggacaaatctttctcccagtggaggaggagagcctaaaggagaattgatg
gaagccatcaaacgtgactttggttccttcgcaaacttcaaggagaaactaacagctgta
tcagttggtgttcaaggatcaggctgggggtggcttggctataataaggagcagggacgt
ctacagatagcagcttgtgcaaatcaagatcctttgcaaggaacaacaggtctcattcca
ttgctgggaatcgatgtatgggaacatgcctattatcttcagtataaaaatgttcgacct
gattatttgaaagctatctggaatgtgatcaactgggagaatgtatcttcaagatatgca
tcttgcaaaaaatag

DBGET integrated database retrieval system