KEGG   Meleagris gallopavo (turkey): 100551031
Entry
100551031         CDS       T01523                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04020  Calcium signaling pathway
mgp04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100551031 (CAMK4)
   04020 Calcium signaling pathway
    100551031 (CAMK4)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100551031 (CAMK4)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100551031 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100551031
NCBI-ProteinID: XP_019466117
LinkDB
Position
Z
AA seq 258 aa
MYCMCFSKTVGNLRVYSCVELKPRRIAKETYLHANGIVHRDLKPENLLYATPAPDAPLKI
ADFGLSKIVEDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSLGIITYILLCGFEPFYD
ERGDHYIYKRTLNCEFDFVSPWWDDVSLNAKDLVRKLIVLDPKKRLTTLQALQHPWVTGK
AANFAHMDNAQKKLQEFNARRKLKAAVKAVVASTRLGSASSHSAHDSSKPSCSASSIRDG
KPEEKSAQEAEAAPEEMS
NT seq 777 nt   +upstreamnt  +downstreamnt
atgtactgcatgtgtttcagcaagacagttggaaacctgagagtctacagctgtgttgaa
ttaaaacctagaaggattgcaaaagagacttacctgcatgcaaatgggattgtgcatcgt
gatttgaagccagaaaatctgctctatgcaacaccagcaccagatgcaccactgaaaata
gctgattttgggctttccaagattgtggaagatcaggtgaccatgaagacagtttgtgga
actccagggtactgcgccccagagatactacgaggatgtgcctatggccccgaagtggac
atgtggtctctagggatcatcacctacattctactttgtggctttgaaccattttatgat
gaaaggggagatcattacatatataagagaaccctgaactgtgaatttgactttgtgtcc
ccctggtgggatgacgtgtctctgaatgccaaggatttagttagaaagttaattgtttta
gatcccaagaaacgcctcaccactctacaggctttgcagcatccttgggtcacaggaaaa
gcagcaaattttgcacacatggataacgcacaaaagaagcttcaagaattcaatgcccgg
cgtaaacttaaggctgcagtaaaagctgttgtggcatcaactcgtcttggcagcgccagc
agtcacagcgctcatgacagcagcaagcccagctgtagtgcatcttctatccgtgacggc
aagcctgaagagaaatccgctcaggaagcagaagcagctccagaagaaatgtcttaa

DBGET integrated database retrieval system