KEGG   Meleagris gallopavo (turkey): 100551071
Entry
100551071         CDS       T01523                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100551071
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mgp03000]
    100551071
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mgp03310]
    100551071
Transcription factors [BR:mgp03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100551071
Nuclear receptors [BR:mgp03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100551071
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100551071
NCBI-ProteinID: XP_031411540
Ensembl: ENSMGAG00000009322
LinkDB
Position
15
AA seq 409 aa
MGNRFSPSYYVCQNATDLNSYFHAFFPSPGLRSDVSSSPSTTSATTGPPPKLCLVCSDEA
SGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNL
EARKTKKKIKGIQQATATGTRDAAEAAGNKSVVPASLPQLTPTLVSLLEVIEPEVLYSGY
DSTLPDSSWRILSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFAL
GWRSYKQSNGNLLCFAPDLIINEQRMNLPCMYEQCKHMLMVARELSRLQVSYEEYLCMKT
LLLLSTIPKEGLKSQTLFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDV
VENLLSFCFQTFLDKSMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgggcaaccgtttctcaccatcatattatgtttgccaaaatgccacagatcttaattca
tattttcatgccttttttcccagccctggactgagatcagatgtaagctcttctccatcc
acaacctcagcgactacgggaccacctcccaagctctgcctcgtgtgctctgacgaggcc
tctgggtgtcattatggtgttcttacttgtggcagctgcaaagtgttcttcaaaagagct
gtggaagggcagcacaactatctctgcgctggaaggaacgactgcattatcgacaaaatc
cggcggaagaactgcccggcgtgccgctatcggaaatgcctccaggcgggcatgaacctc
gaagctcgcaaaacgaagaagaagataaaaggcattcagcaggccactgccacgggcacc
agggatgctgccgaagctgctggaaataagagcgtggttcccgcatcgctgccgcagctc
acccccaccctggtgtcactgctggaggtgatcgagcccgaggtgctgtactcaggctac
gacagcacgctgcccgactccagctggcgcatcctgtcgaccctcaacatgctgggagga
cggcaagtggtggctgcagtcaagtgggcaaaggcaataccaggtttcagaaacttacac
ctggatgaccaaatgacccttctgcagtactcctggatgttcctaatggcttttgcttta
ggatggagatcatacaaacaatcaaatggaaatctcctgtgctttgcaccagacctgatt
attaacgagcagagaatgaatctaccctgtatgtatgaacaatgcaaacatatgctgatg
gttgcccgcgagctgtcacggcttcaagtctcatatgaagagtatctctgcatgaaaaca
ttgcttctcctctctacaattcctaaggaaggcctgaagagccagactttgttcgaagaa
attcgcatgacatacataaaagagctgggaaaggccatcgtgaaaagagaagggaactcg
agccagaactggcagcggttctatcagctgacgaagctgttggactctatgcacgatgtg
gttgaaaatcttctgagcttttgcttccagacgtttttggataaatccatgagtattgag
ttcccagaaatgttggcagaaatcatcagcaaccagataccaaaatactcaaatggaaat
ataaagaagctcttatttcatcagaagtga

DBGET integrated database retrieval system