KEGG   Meleagris gallopavo (turkey): 100551130Help
Entry
100551130         CDS       T01523                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100551130 (TMPRSS9)
Peptidases [BR:mgp01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100551130 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 100551130
NCBI-ProteinID: XP_019465521
Ensembl: ENSMGAG00000000721
LinkDB All DBs
Position
30
AA seq 1111 aa AA seqDB search
MDQIKPVLGRRGPRASCWKVTIIATVVGSVTALYLGILLACHPTAETSFEHTVELRGITF
NSSLQAENSDYYRVLTPALERLFLSSFQDSQLDWSCTGCTILDYRSGNSSVIVRFRLRFA
PQDSQPLSSATEEDALRHGLAAALQEQGLSLAAFGTISSASLTAPSDVSPYRPGLKAGSC
PGDVFMCHNTQCVWKENPECDGRKDCADASDEKGCDCGSRPAMQTASRIVGGTEASRGEF
PWQVSLRENNEHFCGAAILTDRWLVSAAHCFTEFQDPAMWAAYAGTTSISGADSSAVRMG
IARIIPHPSYNTDTADYDVAVLELKRPVTFTKYIQPVCLPHAGHHFPTNKKCLISGWGYL
KEDFLVKPEFLQKATVKLLDQALCSSLYSHALTDRMLCAGYLEGKIDSCQGDSGGPLVCE
EPSGKFFLAGIVSWGIGCAEARRPGVYTRVTKLRDWILDAISPFPTSITRTVPLIHSSTN
SNVVTAEELNATTSTAIPTSSLAASKPATAPRPQECGGRPGLSKPNKIVGGTDASRGEIP
WQVSLQEDSMHFCGATIIGDRWLLSAAHCFNETNPEEIEAYMGTTSLNGTDGSAVKVSVT
RVIPHPLFNPILLDFDVAVLELARPLVFNKYIQPICLPLAVQKFPVGKKCIISGWGNLQE
GNVTMSESLQKASVGIIDQKTCNFLYNFSLTERMICAGFLEGKIDSCQGDSGGPLACEVT
PGVFYLAGIVSWGIGCAQAKKPGVYSRITKLNDWILDTISEFPSPSTGAPSSSATTRTTA
DILTLHPSTTATSPISESTLSEKTTTTVEETSTALKSTEPAKPTHAPVVPCTSLTFRCSS
NVCIGKENPECDEIVDCSNGFDESNCDCGLTTALAFSKIVGGSSAARGEWPWQVSLWLRQ
KEHKCGAVLIADRWLLSAAHCFDIYSDPKMWVAFLGTPFLNGNDGKMEKIFRIYKHPFYN
VYSLDYDVALLELSVPVRFSSTIKPICLPDNSHIFQEGARCFITGWGSTKEGGLMTKHLQ
KAAVNVIGDQDCKKFYPVQISSRMVCAGFPQGTIDSCSGDAGGPLACKEPSGRWFLAGIT
SWGYGCARPYFPGVYTKVTAVQGWIAQNLKL
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaataaagccggtgctgggcagaaggggaccgagggccagctgctggaaggtg
accatcattgccactgtagtgggcagtgtgacagctctctacctagggatcctgctggcc
tgtcatcccacagcagagaccagctttgagcacactgtggagctgcgagggatcaccttc
aacagcagcttgcaggcagagaactcagactattaccgggtgctgacgcccgccctcgag
aggctgtttctgtccagtttccaggactcccagctggactggagctgcactggttgcacc
atcctggactacaggagtgggaactcgagtgtcattgtccgtttccgcctgcgcttcgcc
ccgcaggactcccagcccctcagctctgccacggaggaggacgcactccgacatgggctg
gcggctgcgctgcaggagcagggcctctccctggccgccttcgggacgatatcctcagct
tctcttacagctcccagtgatgtttctccatacagaccaggactgaaagcagggagctgc
cctggtgacgtgttcatgtgccacaacactcagtgtgtgtggaaagaaaaccctgaatgt
gacggccggaaggactgcgccgacgcctctgatgaaaagggctgcgactgtgggagccgc
cctgccatgcagactgccagcaggatagttggaggcacagaggcatccagaggggagttt
ccctggcaagtcagcctgcgagagaacaacgagcacttctgcggtgccgcaatcctcaca
gacaggtggctggtgtctgctgctcactgctttactgagttccaggacccggccatgtgg
gcagcttacgcagggaccacctccatcagcggtgcagacagcagtgcagtgagaatgggc
atcgcccggatcatccctcacccctcctacaacaccgacacggccgactacgacgtggct
gtgctggaactgaagagacctgtgaccttcactaagtacattcagcctgtgtgcctgcca
cacgctgggcatcacttccctaccaacaagaagtgcctgatatctggctggggatacctc
aaggaggatttcttggtgaaacctgagttcctgcagaaggcaacggtaaagctgctggac
caggcgctgtgctccagcctctacagccatgccctcacagacaggatgctgtgtgctggt
tacctggaggggaaaattgactcctgccagggggactctggtgggccgctggtttgcgaa
gaaccatctggcaagtttttcctggcaggaatcgtgagctggggaattggatgtgctgaa
gccaggcggccaggggtttacacacgtgttaccaaactgagagactggatcttggatgct
atttctccctttcctacctccataacacgcactgttccactaatacactccagtactaac
agtaacgtagtcactgctgaagagctcaacgccaccaccagcacagcaatccccacctct
tcactggctgccagcaaaccggcaactgcacccagaccacaagagtgcggaggacgacct
ggcctttctaaacccaacaagattgtgggaggaaccgatgcttccagaggggagatcccc
tggcaggtcagcctgcaggaagactcaatgcatttctgtggggcaacgatcattggagac
cgctggctgctgtcagctgcacactgcttcaacgagacaaatccagaagagattgaagcc
tacatgggaacgacatcactaaatggaactgatgggagcgcagtgaaagtcagtgtaaca
cgagtgatcccacatcctctcttcaaccccatccttctggactttgatgtagctgtactc
gagctggcaagaccccttgtcttcaacaaatacatccagcccatctgcctcccactcgct
gtgcagaagtttcctgttggcaagaaatgcataatttctgggtggggaaacctccaagaa
gggaatgtcaccatgtctgagagcctgcagaaagcctctgtgggcatcatagaccagaag
acctgcaacttcctctacaacttctccctcactgagcggatgatctgcgctggtttcctg
gaggggaagatagattcatgccagggagattcaggagggcccttggcctgcgaggtcacc
ccaggcgtgttttatctggctggcatcgtgagctggggaattggatgtgcccaggctaag
aaacccggcgtgtactccagaattaccaaactcaatgactggattctggataccatctca
gagtttcccagtcccagtacaggcgctccttccagttcagccaccaccagaactactgca
gacatcctcacactccatcccagtacaacagctacaagtcccatcagtgaaagcaccctg
agtgagaagactaccaccaccgtggaagaaacctccacagctctgaaatccaccgagcct
gccaagcccacccatgctccagtggtgccttgtaccagcctcaccttcaggtgttccagc
aacgtctgtattggaaaagaaaatcctgaatgtgatgaaattgttgactgcagcaatggc
tttgatgagagtaattgtgactgcggcttaaccactgctctggccttcagcaagatcgtg
ggtgggagctctgcagctcgaggagaatggccctggcaagtcagtctctggcttcggcag
aaggagcacaagtgcggggctgtcctcattgccgacaggtggctgctctctgcagctcac
tgctttgatatttacagtgaccccaaaatgtgggtggcctttctaggaacacccttcctg
aacggcaacgatggcaaaatggagaaaatatttcgtatctacaagcatcctttttacaac
gtctacagcctggactacgacgtggcactgctggagctgagtgtgcctgtcaggttcagc
agcaccatcaaacccatttgtctcccagacaactcacacatcttccaggagggagccagg
tgcttcatcacaggctggggctccaccaaggaaggaggcctcatgacaaagcatctgcaa
aaagcagcagtgaatgtgattggagatcaggactgcaaaaagttctatcctgtccagatc
agcagcaggatggtgtgtgctggtttcccacagggtaccatcgacagttgctcaggtgat
gcaggtgggcccctggcatgtaaagaaccctcaggacggtggtttctagcaggaatcaca
agctggggctatggctgtgccaggccatacttccctggagtctacaccaaagtcacggca
gtgcaaggctggatcgctcagaatctcaagctctga

DBGET integrated database retrieval system