KEGG   Meleagris gallopavo (turkey): 104910570
Entry
104910570         CDS       T01523                                 

Gene name
RCHY1
Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104910570 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    104910570 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mgp04121]
    104910570 (RCHY1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104910570 (RCHY1)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    104910570 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-C3HC4_3 zf-RING_11 Prok-RING_4 zf-RING_5 zf-RING_UBOX zf-RING_4 zf-rbx1 zf-UDP HypA Zn_ribbon_17 zf_Rg
Other DBs
NCBI-GeneID: 104910570
NCBI-ProteinID: XP_010707920
LinkDB
Position
4
AA seq 141 aa
KKLISIQQCNFVFVFAKCIENVSRQDCPICLEDIHTSRVEARVLPCGHLLHKTCYEEMLK
EGYRCPLCMHSALDMRRYWRQLDDEVAQTPMPTEYQNMMVEILCNDCNSRSTVQFHLLGM
KCTNCESYNTAQDGKSKQPVE
NT seq 426 nt   +upstreamnt  +downstreamnt
aaaaagttgatatccatacagcagtgtaactttgtctttgtctttgccaagtgtatcgaa
aatgtctccaggcaggattgtcccatatgcttggaggacattcacacatcccgtgtggaa
gctcgcgttctgccatgcggtcaccttctccacaaaacatgttatgaagagatgttaaaa
gaagggtacaggtgtcctttgtgcatgcactctgctttagatatgagaaggtactggcgt
cagctggatgatgaagtagcacaaactccgatgcccacagagtatcagaacatgatggtg
gagattctttgtaatgattgcaattcccggtctactgtgcagttccatctcctaggcatg
aagtgtacaaactgtgaatcgtacaatactgcccaagatggaaaatccaagcagcctgtg
gagtag

DBGET integrated database retrieval system