KEGG   Meleagris gallopavo (turkey): 104911603
Entry
104911603         CDS       T01523                                 

Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04068  FoxO signaling pathway
mgp04114  Oocyte meiosis
mgp04115  p53 signaling pathway
mgp04150  mTOR signaling pathway
mgp04510  Focal adhesion
mgp04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104911603
   04068 FoxO signaling pathway
    104911603
   04150 mTOR signaling pathway
    104911603
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104911603
   04115 p53 signaling pathway
    104911603
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104911603
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104911603
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mgp04052]
    104911603
Cytokines and growth factors [BR:mgp04052]
 Growth factors
  Growth factors (RTK binding)
   104911603
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 104911603
NCBI-ProteinID: XP_010711495
LinkDB
Position
1
AA seq 99 aa
GAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKP
PKSARSVRAQRHTDMPKAQKELHLKNTSRGNTGNRNYRM
NT seq 300 nt   +upstreamnt  +downstreamnt
ggtgctgagctggttgatgctcttcagttcgtatgtggagacagaggcttctacttcagt
aagcctacagggtatggatccagcagtagacgcttacaccacaagggaatagtggatgaa
tgctgcttccagagttgtgacctgaggaggctggagatgtactgtgctccaataaagcca
cctaaatctgcacgctctgtacgtgctcagcgccacactgatatgccaaaagcacaaaag
gaactgcatttgaagaatacaagtagagggaacacaggaaacagaaactacagaatgtaa

KEGG   Meleagris gallopavo (turkey): 678666
Entry
678666            CDS       T01523                                 

Definition
(RefSeq) insulin-like growth factor I precursor
  KO
K05459  insulin-like growth factor 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04068  FoxO signaling pathway
mgp04114  Oocyte meiosis
mgp04115  p53 signaling pathway
mgp04150  mTOR signaling pathway
mgp04510  Focal adhesion
mgp04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    678666
   04068 FoxO signaling pathway
    678666
   04150 mTOR signaling pathway
    678666
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    678666
   04115 p53 signaling pathway
    678666
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    678666
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    678666
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mgp04052]
    678666
Cytokines and growth factors [BR:mgp04052]
 Growth factors
  Growth factors (RTK binding)
   678666
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 678666
NCBI-ProteinID: NP_001290078
Ensembl: ENSMGAG00000013066
UniProt: O93380
LinkDB
Position
1
AA seq 153 aa
MEKINSLSTQLVKCCFCDFLKVKMHTVSYIHFFYLALCLLTLTSSAAAGPETLCGAELVD
ALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSARS
VRAQRHTDMPKAQKELHLKNTSRGNTGNRNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggaaaaaatcaacagtctttcaacacaattagttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacactgtgtcctacattcatttcttctaccttgccctgtgtttgctt
accttaaccagttctgctgctgctggcccagaaacactgtgtggtgctgagctggttgat
gctcttcagttcgtatgtggagacagaggcttctacttcagtaagcctacagggtatgga
tccagcagtagacgcttacaccacaagggaatagtggatgaatgctgcttccagagttgc
gacctgaggaggctggagatgtactgtgctccaataaagccacctaaatctgcacgctct
gtacgtgctcagcgccacactgatatgccaaaagcacaaaaggaactgcatttgaagaat
acaagtagagggaacacaggaaacagaaactacagaatgtaa

DBGET integrated database retrieval system