KEGG   Meleagris gallopavo (turkey): 104911865
Entry
104911865         CDS       T01523                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04020  Calcium signaling pathway
mgp04260  Cardiac muscle contraction
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04270  Vascular smooth muscle contraction
mgp04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104911865
   04020 Calcium signaling pathway
    104911865
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104911865
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104911865
   04261 Adrenergic signaling in cardiomyocytes
    104911865
   04270 Vascular smooth muscle contraction
    104911865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mgp04040]
    104911865
Ion channels [BR:mgp04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104911865
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 104911865
NCBI-ProteinID: XP_010712413
LinkDB
Position
1
AA seq 882 aa
MVCQCTASPGSITRIRNSAVSSQHSSVLCGPGPLFLSCCCNSCLCDNGFQNAEENSRISI
TFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKI
ALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPDKKCDPESEPANSTEADH
SCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYD
PEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFAL
VRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQ
EYFRKFKKRKEQGLVGKPSQRNALSLQFAVLQAGLRTLHDIGPEIRRAISGDLTAEEELD
KAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKSGNNQGDT
ESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSYPSTVSTVEGHGTPLSP
TIRVQEAPWKLPSKRTHYYETLGRSSSRDSQLAIVCQEEVSQDETYDENLNEDIEYCSEP
SLLSTEMLAYQDDENRQLTPPENNKGEDTRHSPKKGFLCSSALGRRASFHLECLKRQKNQ
GVDVSQKTVLPLQMVHHQALAVAGLSPLLQRSHSPTTFSRLCATPPATPCSRGWPQQPIP
TLRLEGAESSEKLNSSFPSVHCSSRFPDSSDSPRRARPVSLTVPSQTAGSSRQLHGSASS
LVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAADNILNGNSKQSPNGNLL
PFVNCRDAGQDSAGEEEEEVQNPDCRKSQEELKDSRIYISSL
NT seq 2649 nt   +upstreamnt  +downstreamnt
atggtgtgccagtgcactgcaagcccagggagcattaccaggataaggaacagtgcagtg
agctctcagcatagctctgtgctctgtggcccagggcccttgtttctctcgtgctgttgt
aactcctgcctctgtgacaatggcttccagaacgcagaggaaaactctcgcatctcaatc
accttcttccgactcttccgcgtgatgcgtcttgtgaagctcctgagccgaggggagggc
atccggacactgctttggaccttcatcaagtccttccaggctctcccctatgtggctctt
ctaatagtgatgctgttcttcatctacgccgtgattgggatgcaggtatttggtaaaatt
gcgctgaacgataccacagaaatcaaccgcaacaacaacttccagaccttcccccaagcg
gtgctgctgcttttcaggtgtgccaccggtgaggcctggcaggaaatcatgctggcgtgt
ctcccagacaagaagtgcgacccagagtcagagccagccaactccactgaagctgaccat
tcctgtggcagcagcttcgctgtcttctacttcataagcttctacatgctctgtgccttc
ctgatcatcaatctttttgtagctgttataatggataacttcgattacctgacacgggac
tggtccattttaggaccacatcacctagatgagtttaaaaggatctgggcagagtatgac
cctgaagccaagggacggatcaagcacttggacgtggtgacattgctccggcggattcag
cctccactgggcttcgggaagctttgccctcaccgagtggcttgcaaacgccttgtctcc
atgaatatgccactgaacagcgatggaactgtcatgttcaatgccactctctttgcactg
gttagaactgcactgaggatcaagacggaaggtaacctggagcaagccaatgaagagctt
agagcaataattaagaaaatctggaagcgcaccagtatgaagttgctggaccaggtggtg
cctcctgcaggtgatgatgaggtgactgttgggaagttctacgccactttcctgattcaa
gagtatttccggaaattcaagaaacgcaaagagcagggcctggtgggcaagccttcccag
cgcaacgcactctccttgcagtttgctgttttgcaggctggtttgcgcacacttcacgac
attggtccagagatccgacgagcgatctctggagacctgacagctgaagaagagctagat
aaggctatgaaagaagctgtttctgctgcctctgaagatgatatcttccggagagccgga
ggcttgtttggaaaccatgtcagttattaccaaagtgatggcaggagtgcgttcccccag
acattcaccacccagcgacctttgcacatcaataagtctggcaacaaccagggagatacc
gagtctccatctcatgagaagttggtggactccaccttcactcccagcagctactcatct
tcaggctccaatgcaaacatcaacaatgccaacaacactgccctgtgccgcttcccaagc
ccacccagctatcccagcactgtcagcacagtggaaggccatgggactccattgtcaccc
accatacgtgtgcaagaagctccttggaaattaccatccaaaaggacgcactactacgaa
acattgggacgctccagttccagagacagccagctggcaattgtttgccaagaggaagtg
tctcaggatgagacttatgatgaaaatttgaatgaagacattgagtactgtagtgaacca
agtctgctctctactgaaatgctcgcataccaagatgacgaaaacagacaacttactcca
ccagaaaacaacaaaggagaggacacccggcactctccgaagaaagggtttctgtgctcc
tcagcactaggtcgacgagcatcttttcacttagagtgtctgaaaagacagaaaaaccag
ggcgtagatgtctcgcagaagacagttctgcctttacaaatggtacatcatcaggcattg
gcagtggccggcctgagccccctcctccagcgaagccattcccccaccacgttctcccgg
ctgtgtgccacaccgcctgctacaccctgcagccgaggctggccacagcagcccatcccg
acgctgcgcctcgagggggctgagtccagcgagaagctcaacagcagcttcccctccgtg
cactgcagctccagattccccgacagctctgacagcccaagaagagccaggccggtgtcc
ctcaccgtccccagccagacagcggggagcagcaggcagttgcatggcagcgccagcagc
ctggtcgaagcggtattgatttcggaaggactgatgcagtttgctcaagatccaaagttc
attgaggtcacgacccaggaactcgctgatgcctgcgacatgacgatagaagagatggaa
aacgcagcagacaacattctcaatggtaacagcaagcagagccccaatggcaacctgttg
ccttttgttaactgcagggacgcagggcaggacagtgcaggcgaggaagaggaagaggtg
cagaacccggattgtagaaaaagtcaggaggagctgaaggacagcaggatttatatcagc
agcctgtag

DBGET integrated database retrieval system