KEGG   Meleagris gallopavo (turkey): 104913316
Entry
104913316         CDS       T01523                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104913316
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mgp03000]
    104913316
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mgp03310]
    104913316
Transcription factors [BR:mgp03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    104913316
Nuclear receptors [BR:mgp03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   104913316
SSDB
Motif
Pfam: GCR
Other DBs
NCBI-GeneID: 104913316
NCBI-ProteinID: XP_010717530
LinkDB
Position
15
AA seq 390 aa
MDSKELLKSSDQETGKNVLMSTKGGIVMDFHPPFRGGASAQAPVSAAPLPVSSQSDSAQQ
PALADFSKGLVNNVPPPDLSKAVSLSMGLYMGETDAKVMGNDLGFSQQSQTGIPSGETDF
RLLEESIASLNKSSSLAEDTKGAVSSEAPLEPDFAGMAGRGPLEPGASVQSQVGSNGGSL
KLFSEDQSTLDILQDLELPSVSPGKEPNGSPWRLDPLLDDGGLLSPISADDTFLLEGNLG
EDCKPPILSDTKPKINDRGDLLPSSKMPMPQVKTEKEDYIELCTPGIKQENMGPIYCQAN
FSGSNLLGTKVSAISIHGVSTSGGQMYHYDLNTASLSQQQDQKPIFNIIPSLPASSENWN
RCQGSGDEALAPLGTLNLSGRPAFSNGYSR
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggattccaaagaattgcttaagtcgtcagatcaagaaaccgggaaaaatgtgctcatg
agtaccaaaggagggatcgtgatggacttccatccacccttcaggggtggagcctccgca
caagcccctgtatctgcagctcctctccccgtgtcttctcagtcagactctgctcagcaa
cccgctctggctgacttctcaaaaggattggtaaacaatgtgcctccgccggacctgtcc
aaggcagtgtcactctccatgggactgtatatgggtgaaacagatgcgaaagtgatggga
aacgaccttggattttcacaacagagccaaactggcatcccttctggagaaacggacttc
aggctcctggaggaaagcatagcaagcttgaacaagtcctcgagcctggcagaggacacg
aagggagcagtgtcatccgaggcgccgctggagccggactttgcgggcatggctggccgc
ggccccctggagccgggggcttcggtccaaagccaagtcggctccaacggcggcagcctg
aagctgttctctgaagaccaaagcaccctggatatcctccaggacttagaattgccatcg
gtatcgcctggcaaggagccgaatgggagtccgtggcggctggacccgttgctcgatgat
ggaggtttgctgtcccccatctctgctgacgacacgttccttctggagggaaacctgggg
gaagactgcaagccccccattttgtctgacactaaacctaaaattaatgaccgtggtgac
cttttacccagttccaaaatgccaatgccgcaagtgaaaacggaaaaggaagactacatt
gaactctgtactcctggcataaagcaagaaaacatgggcccaatttactgtcaggcaaac
ttctctgggtctaatctgctgggtactaaagtctctgccatctctatccatggtgtcagc
acctctgggggacagatgtatcactatgatttaaatactgcatcgctctctcagcagcag
gatcagaaaccaatttttaatatcattccatctcttcctgccagttcagaaaattggaat
aggtgccagggatcaggggacgaggctctagctcccttgggaacgctcaacctttctggc
agacctgctttctctaacggctattcaaggtaa

DBGET integrated database retrieval system