KEGG   Meleagris gallopavo (turkey): 104913334
Entry
104913334         CDS       T01523                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104913334
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104913334
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mgp04052]
    104913334
   00536 Glycosaminoglycan binding proteins [BR:mgp00536]
    104913334
Cytokines and growth factors [BR:mgp04052]
 Growth factors
  Growth factors (RTK binding)
   104913334
Glycosaminoglycan binding proteins [BR:mgp00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   104913334
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 104913334
NCBI-ProteinID: XP_010717588
LinkDB
Position
15
AA seq 140 aa
MPNIPVLWMQQKHLGHYLSPLSLFPFPYFPFYVTVVVLFLLPVQLQLSAEDVGEVYIKST
ASGQYLAMDPNGLLYGSLPGEECLFLERLEENHYNTYISKKHADKNWFVGLKKNGNSKLG
PRTHYGQKAILFLPLPVSAD
NT seq 423 nt   +upstreamnt  +downstreamnt
atgccaaatattccggttctctggatgcaacagaaacacctgggccattatctctcacca
ctttccctttttccatttccttattttcctttttacgttactgttgttgttttattttta
cttccagttcagctccagctcagtgcggaagacgtgggcgaggtctatataaagagcacg
gcgtcggggcagtacctggcaatggaccccaacgggctcctgtacggctcgctaccaggc
gaggagtgcctgttccttgagaggctcgaggagaaccattacaacacatacatctccaaa
aagcacgcagacaagaactggttcgtcgggctgaagaaaaacgggaacagcaagctgggg
ccgcggactcactatgggcagaaggcgatcctcttcctcccactgccagtgtcggccgac
tga

DBGET integrated database retrieval system