KEGG   Meleagris gallopavo (turkey): 104913693Help
Entry
104913693         CDS       T01523                                 

Definition
(RefSeq) putative UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase LOC100288842
  KO
K03766  beta-1,3-N-acetylglucosaminyltransferase 5 [EC:2.4.1.206]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mgp01100  Metabolic pathways
Module
mgp_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
mgp_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    104913693
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mgp01003]
    104913693
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.206  lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
     104913693
Glycosyltransferases [BR:mgp01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   104913693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 104913693
NCBI-ProteinID: XP_010719330
LinkDB All DBs
Position
19
AA seq 367 aa AA seqDB search
MQLCRLRTHQWCFVLFNVLLFHMLLFGADLLEEYFLRSLPLSYSDAKALEIRERARKLDT
ASLKANLSRSYTVSSTACSDQEIFLLVLVCSSPGNRTRRNAIRQTWGNVTDTTGYAVLTL
FALGRPASVEAQQEIDEESQKHRDIIEGSFIDCPATQTQKMMMIVEWVVTFCPHARYTLK
TDEEMFVGIPSLAGYLLSLTQLEDVYSGRVIHQGVPDRDPQSPSFVPIHQYPEEFYPDYC
DRRAFVMSQDVVRKVFVAAQEVPTSVPADVFVGICAKKAGITPIHSSRFSGEKHISYNRC
CYKFIFTSSNMNEDELFKDWKETSDGKDCSLLETYYSLVSCRVLTYIDKFKQFNLDRIKS
EAFHVSD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgtgcagactccggacccaccagtggtgctttgttctgttcaatgtcctgctg
ttccacatgctgcttttcggggcagacttgctggaggaatacttcctgcggtccttacct
ctctcctacagcgatgcgaaggccctggagatcagggagcgggccaggaagctggacaca
gcctcgttgaaggccaacctctccaggtcttacactgtcagcagcacagcgtgctctgat
caagagatatttctgcttgttctcgtctgcagcagcccaggaaacaggacgaggcgcaat
gccatcaggcagacgtggggcaatgtgacagacaccacgggttatgctgtcctcactttg
tttgctttgggaaggccagcttcggtagaagcccagcaggagattgatgaagagtcgcaa
aagcacagagatattatcgagggcagcttcatcgattgtcctgcaactcagacacagaag
atgatgatgattgtggagtgggtggtgactttctgtcctcacgcaaggtatacccttaag
acagacgaagaaatgtttgttggcattcccagcctggctggatacttgctcagcttgact
caactagaggatgtctacagtgggagggtcatccatcaaggggtgcctgacagagacccc
cagagccccagctttgtccccatccatcaataccccgaggagttttacccggattactgt
gacaggagagccttcgtcatgtcgcaggacgtcgtgcgcaaggtgtttgtggctgcccag
gaggtgccaacttcagtgcctgccgatgtcttcgttgggatctgtgctaagaaagctggc
atcactcccattcacagctctcgcttttctggggaaaagcacatcagctacaatcgatgc
tgctataaattcatttttacctcttccaacatgaacgaggatgagctatttaaggattgg
aaggaaacaagtgatgggaaagactgctcgctactggaaacgtactacagcctggtgtcc
tgcagggttctgacctatattgataagttcaaacagtttaacttggacagaataaaaagt
gaggctttccatgtctctgattaa

DBGET integrated database retrieval system