KEGG   Meleagris gallopavo (turkey): 104914505
Entry
104914505         CDS       T01523                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04012  ErbB signaling pathway
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104914505 (CDKN1A)
   04068 FoxO signaling pathway
    104914505 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104914505 (CDKN1A)
   04115 p53 signaling pathway
    104914505 (CDKN1A)
   04218 Cellular senescence
    104914505 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 104914505
NCBI-ProteinID: XP_010722537
LinkDB
Position
28
AA seq 190 aa
MAETINTPQREPRIAGRSHSVHSSAPGSHPPHIPLPTAAMPLSQSRAGPMPCSSKVCRNL
FGPVDHEQIQNDFEELLRQQLEEAQRRWNFNFETETPLEGHFKWERVLLAEQPSRGAFSL
AKATSGGDNGSSAPCRVAPKDGVDGVHHGAAQQSSEPTRVGSPQRLKRGQTTVKDFYSSK
RRVVHDKPKL
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcagagaccattaacacccctcagcgtgagcccaggattgctggcaggtcccattct
gtgcacagctctgccccgggctcacatcccccccatatccccctccccacagccgcaatg
ccgctgtcacagagcagagccgggccgatgccgtgcagcagcaaagtgtgcaggaacctc
ttcggccccgtagaccacgagcagatccagaacgactttgaggaactgttgaggcagcag
ctggaagaagctcagcggcgctggaacttcaacttcgaaacggagacgcccctggaaggg
catttcaagtgggagagggtcctgctggcagagcagccctcccggggggccttcagcttg
gccaaggccaccagcgggggggataatgggagctcagcaccctgcagggtcgcccccaag
gatggtgtcgatggggtccatcatggggcagcccagcagagctcggagcccaccagggtc
ggttctccacagcgcttgaaacgtgggcagaccaccgtcaaagatttctacagctccaag
agaagagttgtccacgacaagcccaagctgtga

DBGET integrated database retrieval system