KEGG   Meleagris gallopavo (turkey): 104914907
Entry
104914907         CDS       T01523                                 

Gene name
ERCC8
Definition
(RefSeq) DNA excision repair protein ERCC-8 isoform X1
  KO
K10570  DNA excision repair protein ERCC-8
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
mgp04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104914907 (ERCC8)
  09124 Replication and repair
   03420 Nucleotide excision repair
    104914907 (ERCC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mgp04121]
    104914907 (ERCC8)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    104914907 (ERCC8)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     104914907 (ERCC8)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      104914907 (ERCC8)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Ge1_WD40 Cytochrom_D1
Other DBs
NCBI-GeneID: 104914907
NCBI-ProteinID: XP_010723750
LinkDB
Position
Z
AA seq 300 aa
MLGFISARQAGLDDPLRLRRAESTRRVLSLELNKDRDVERIHGSGINTLDIEPVEGRYML
SGGSDGVIVLYDLENLSRKPNYTCKALCSVGRSHPDAHKFSVETVQWYPHDTGMFTSSSF
DKTLKIWDTNTLQPADVFQFEETVYSHHMSPIATKHCLIAVGTKSPKVQLCDLKSGSCSH
ILQGHRQEVLAVSWSPRHEYVLATASADSKVKLWDVRRASGCLTTLDQHNGEKSKASSEA
VNTAHNGRVNGLCYTSDGLHLLTVGTDDRMRLWNSSTGENTLVSYQESSVSFCFDLKDFF
NT seq 903 nt   +upstreamnt  +downstreamnt
atgttggggtttatttcggctcgtcaggccgggctcgacgatcccttgcggctgcgccgg
gctgagtctacccgcagggttctaagcttagaattaaataaagatagagatgtggaaaga
atacatggcagtggtattaacacccttgatattgagcctgttgagggaagatacatgtta
tcaggtggctcagatggtgttattgttctttatgatcttgaaaacttgagcagaaaacca
aattacacatgtaaagcactttgttctgtgggaaggagccatcctgatgcacataaattc
agtgtggagacagtccagtggtatcctcatgatactggaatgtttacatcgagctcattt
gataaaaccttgaaaatatgggatactaatactttacagcctgcagatgtatttcagttt
gaggaaacagtctatagccatcacatgtctccaattgctacaaaacattgtttaatagca
gttggtaccaaaagccccaaagtacagctctgtgacttgaagtctggatcctgttctcac
attctgcagggtcacaggcaagaagtactggcagtatcttggtccccacgtcatgaatat
gttttggcaacagcaagtgctgacagtaaagtaaaattatgggatgtgaggagagcgtct
ggatgtctgactacgcttgatcaacacaatggagagaagtcgaaagcatcttctgaggca
gtaaacacagctcacaatgggagagttaatggtttatgctatacaagtgatggtcttcat
ctcttaactgttggtacagatgatcggatgagactttggaacagctccactggagaaaat
acactggtaagttaccaagaatcttcagttagcttttgctttgatttaaaggatttcttt
taa

DBGET integrated database retrieval system