KEGG   Meleagris gallopavo (turkey): 104915230
Entry
104915230         CDS       T01523                                 

Gene name
RAD23B
Definition
(RefSeq) UV excision repair protein RAD23 homolog B
  KO
K10839  UV excision repair protein RAD23
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
mgp04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104915230 (RAD23B)
  09124 Replication and repair
   03420 Nucleotide excision repair
    104915230 (RAD23B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mgp03051]
    104915230 (RAD23B)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    104915230 (RAD23B)
Proteasome [BR:mgp03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    104915230 (RAD23B)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      104915230 (RAD23B)
SSDB
Motif
Pfam: UBA XPC-binding UBA_3 CUE UBA_2 DUF1421
Other DBs
NCBI-GeneID: 104915230
NCBI-ProteinID: XP_010724307
LinkDB
Position
Z
AA seq 251 aa
LPLHLSSSYSTTGDTSRSNLFEDAISALVTGQSYENMVTEIMSMGYEREQVIAALRASFN
NPDRAVEYLLMGIPGDNQAMAEPAQAASTGTSQSSAVAAAVATIPTTATSLGGHPLEFLR
NQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIHMLNEPVIESRQGLS
GSDDSASTGGVAEAGNGHMSYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAA
NFLLQQNFDED
NT seq 756 nt   +upstreamnt  +downstreamnt
ttaccattgcacttgtcttcatcttacagtacaacaggtgatacatctcgatcaaatctt
tttgaggatgctataagtgcacttgtgacaggtcagtcctatgagaatatggtgactgaa
attatgtccatgggctatgaacgtgagcaagtaattgcagcactgagagccagcttcaac
aatccagacagagcagtggaataccttttaatgggtatacctggagataatcaggctatg
gctgaaccagctcaagcagcaagcactggtacctctcagtcttcagcagtggcagcagct
gtagcaaccatacctacaactgctacttcacttggaggacatcctcttgagttcttgcga
aatcagcctcaattccagcagatgagacaaatcattcagcaaaatccttctctgttacca
gcactgctgcaacagattggacgagaaaatcctcaactactacagcaaataagccaacat
caggagcattttattcatatgctgaatgagccagttatagagtctcgacaaggtttaagt
ggcagtgatgatagtgccagcactggaggagtagcagaagctggaaatggtcatatgagc
tacattcaagtaacaccccaggaaaaagaagctattgaacggctaaaggcattaggattt
cctgaaggacttgtgatacaagcatattttgcttgtgagaagaatgaaaacttggccgcc
aattttcttctacaacagaacttcgatgaagattga

DBGET integrated database retrieval system