KEGG   Meleagris gallopavo (turkey): 104916584Help
Entry
104916584         CDS       T01523                                 

Definition
(RefSeq) trypsin I-P1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04080  Neuroactive ligand-receptor interaction
mgp05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104916584
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    104916584
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mgp01002]
    104916584
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    104916584
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     104916584
Peptidases [BR:mgp01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104916584
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104916584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 PD-C2-AF1
Motif
Other DBs
NCBI-GeneID: 104916584
NCBI-ProteinID: XP_010725914
LinkDB All DBs
Position
Un
AA seq 248 aa AA seqDB search
MKYLLFVTFVGVAVAFPISDGDDDKIVGGYSCARNAVPYQVSLNSGYHFCGGSLISSQWV
LSAAHCYKSSIQVKLGEYNLAVQDGNEQTISSSKVIRHSGYNANTLNNDIMLIKLSKAAT
LNSYVNTVPLPTSCVSAGTTCLISGWGNTLSSGTLYPDIVQCLNAPVLSSSQCSSAYPGQ
ITSNMICVGYLTGGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQKGYPGVYTKVCNYVSW
IQSTIASN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacttactgtttgtcacctttgtgggtgtggctgttgccttccccatcagcgat
ggggatgacgacaagattgtgggaggctacagctgtgcaaggaacgctgtaccctaccag
gtgtctctgaattctggatatcacttctgtggaggttctctcatcagcagccaatgggtg
ctgtcagcggctcactgctacaagtcttccattcaagtgaagcttggggaatacaacctg
gcagtccaagacggcaacgagcagaccatcagttcatctaaagtcatccgccactctggc
tacaatgccaacacactgaacaacgatatcatgctcatcaaactttccaaagcagccacg
ctcaactcctatgtcaacactgttcctctgcctaccagctgtgtgtctgctggaacaaca
tgcctgatctccggatggggcaacacactcagcagtggcactctgtatccagatatcgtg
cagtgtctgaatgcccctgtactctcctcaagccagtgcagcagtgcttaccctggtcaa
attactagcaacatgatatgtgtcggatacctgactggagggaaagactcctgccagggg
gattccggtggtccagtagtctgcaatggtcagctgcagggtattgtctcctggggtatt
ggatgtgcacaaaaaggttatcccggtgtttacactaaggtttgcaattatgtttcctgg
attcaatcgactatagcttccaactga

DBGET integrated database retrieval system