KEGG   Meleagris gallopavo (turkey): 692136
Entry
692136            CDS       T01523                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00220  Arginine biosynthesis
mgp00330  Arginine and proline metabolism
mgp01100  Metabolic pathways
mgp04020  Calcium signaling pathway
mgp04146  Peroxisome
mgp04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    692136 (NOS2)
   00330 Arginine and proline metabolism
    692136 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    692136 (NOS2)
   04020 Calcium signaling pathway
    692136 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    692136 (NOS2)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     692136 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 DUF1400
Other DBs
NCBI-GeneID: 692136
NCBI-ProteinID: NP_001290142
Ensembl: ENSMGAG00000008503
UniProt: H6S058
LinkDB
Position
21
AA seq 1136 aa
MLCPWQFAFKPRVVKNQSSEEKDINNNVEEDTKFHGFVKDDAKLHSLSKKQMEMSPIITS
AEKPPQNGIKASNQISRCPRHVKVRNLENGSSLLDTLHLTAKEVINCRTKACQGALMTPK
GLVRGTRDGPVPPAELLPQAIDFVKQYYSSFKELKIEEHLARLETVTKQIETTGTYHLTK
DELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEYICRHIQYAANNGNIRSA
ITIFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSIIGDPASVEFTKLCIELGWKPKYGRFD
VVPLILQANGQDPEIFEYPPEIILEVPMEHPKYEWFKELDLKWYALPAVANMLLEVGGLE
FTACPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNKLASLWKDRAVVEINVAVL
HSFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWIVPPMSGSITPVFHQEMLNY
VLTPFFYYQVDAWKTHIWHDETRRPKKREIKLSVLAKAVLFASLLLRKTMAARSKVTVIY
ATETGKSETLANNLCSLFSCAFNTKILCMDDYNISDLEKETLLLVVTSTFGNGDSPNNGK
TLKNALLTMKLLRKKIRYAVFGLGSTMYPEFCAFAHAIDQKLSQLGALQLTPVGEGDELN
GQEEAFRTWAVIAFKTACDIFDIRGKNSIQLPEIYTSDDSWNPKKYRIVHDSQTMDLTKA
LADIHAKDIIPMKLKFRQNLQSFKSSRVTILVKLSCESNQEVHYLPGEHIGIFPGNQPEL
VHSLIARVKDAPPADQTIRLETCSEGGYWANEKKIPACTLSQALTYLLDITTPPSQQFLK
KLSQLVTAEGDKQRLEVLCHSTEEYNKWKFYNSPNILEVLEEFPSAEVSTAFLLTQLPLL
KPRYYSVSSSCDMTPREIHLTVAVVNYRTRDGQGPLHHGVCSTWLNKIALNETVPCFVRS
ADGFQLPKEPAKPCILIGPGTGIAPFRSFWQQRLYDLEKKGIKAGDMILLFGCRQPDMDH
IYKEEVEEMKRKGVLKEVFTAYSRLPGQPKVYVQDILQNELETKVCNILHKEEGHLYVCG
DVRMARDVAQTLKRMLVKNLDHTEKQAEEYFFQLKSQKRYHEDIFGAVFPHEVKRT
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgctgtgcccatggcagtttgcattcaaacctcgtgttgttaagaaccagtcctctgaa
gagaaggatatcaataataacgtggaggaagatacaaagttccatggctttgtgaaagat
gatgccaaattacacagcctaagcaagaagcagatggagatgtcacctataatcacttca
gcagagaaacccccacaaaatggtatcaaagcttcaaaccaaatatcaagatgtcctaga
catgtaaaagtaaggaacttggaaaacggatccagccttcttgacacattacacctgaca
gcaaaggaggttatcaactgtcggaccaaagcttgccaaggagcactcatgaccccaaag
ggcctggtgagaggcactagagacgggccagttcctccagcagagcttctgcctcaggca
atagactttgtcaagcagtactacagttcatttaaagagttaaaaatagaagagcacctg
gcccgactagaaacagtgaccaaacagatagaaacaacaggaacctaccatctgacaaag
gatgaactgatctttgctgccaaacaggcctggaggaatgctccaaggtgtattgggaga
attcagtggtccaatctacaggtatttgatgcacgtgattgtaaaacagccaaggaaatg
tttgaatatatctgtcgccatattcagtatgccgcaaacaatggaaatataagatcagcc
atcaccatcttccctcagaggactgatgggaaacatgatttccgtgtgtggaacagccag
ctcatccgatacgctggatatcaaatgccagatgggtctatcataggagaccctgcaagt
gtggagttcacaaagttgtgcattgagcttgggtggaagccgaagtatggccgctttgat
gtagttccactcattctccaagcaaacggccaagatccagaaatatttgaatacccgcca
gagattatccttgaagtgccaatggagcatccaaaatatgaatggtttaaggagttggat
ctgaagtggtatgctctacctgctgttgccaacatgctccttgaggtgggaggcctggaa
tttactgcatgtcctttcaacggctggtacatgggaacagagattggagtgcgagacttc
tgtgatgtacagcggtacaatatcctgaaggaggttggaagaagaatgggactggaaaca
aacaaacttgcatcattgtggaaggaccgagctgttgtagagataaatgtggctgtgctt
catagcttccagaaacaaaatgttactatcatggatcatcactcagctgctgagtccttc
atgaaatacatgcagaatgagtaccgtgtgcgaggaggctgcccagctgactgggtgtgg
attgtacctcctatgtcagggagcataactcctgtgttccaccaggagatgttgaactat
gtcctcactcccttcttttactaccaggtggatgcatggaaaacacacatctggcatgat
gagacccgtaggccaaagaaaagagaaataaagttgagcgttttggccaaggctgtactc
tttgcgtcattgctcctgcgaaaaacaatggcagccaggtccaaggtgactgtgatctat
gcaacagagactgggaaatcagaaacattagccaacaatctgtgcagtttgttcagctgt
gccttcaacactaagattctgtgcatggatgattacaacatcagtgacttggaaaaagaa
acacttcttttagtggttaccagcacttttggaaatggagattctccaaataatggaaag
acattaaagaacgccttgctcaccatgaaattgctgagaaaaaaaattagatatgctgtg
tttggcttggggtccaccatgtatcctgagttctgtgcctttgctcatgccattgaccaa
aaactgtcccagctgggggctttgcagctcactccagtgggtgaaggagatgaactcaat
ggtcaagaagaagcctttcgcacgtgggcggtcattgcattcaagactgcctgtgacatt
tttgatatccgtgggaaaaacagtattcagttacctgagatatacacatcagatgacagc
tggaatcctaagaaatataggatagtacatgactctcaaaccatggacttgactaaagca
ctggcagacattcatgcaaaggatataattcccatgaagctgaaattcagacagaatctt
cagagtttcaaatccagtcgtgttaccattctagttaagctttcctgtgagtctaatcag
gaagtgcactacctgcctggagaacatattgggattttcccaggcaaccagccagaatta
gtccacagcctcattgcacgtgttaaggatgcccctccagctgatcagactatcagactt
gaaacctgttctgaaggtggctattgggcaaatgagaaaaagattccagcttgcacactc
tcccaggctttgacatatttacttgatatcactactccaccctcccaacaatttctaaaa
aaactctcccagctggtaacagcggaaggagacaaacagaggctggaagttttatgtcat
agcacagaagaatacaataaatggaagttttacaacagcccaaacatcctggaggtcctg
gaagagtttccttctgctgaagtctcaacagctttcttactgactcagctgccacttctg
aaacccagatactactctgtcagttcctcctgtgacatgacacccagagagattcatctg
acggttgctgtggtaaactacaggacaagagatggacaagggccattgcaccatggagtc
tgcagcacgtggctgaacaaaatagctctcaatgaaacagtcccttgctttgtgcgcagt
gctgatggattccagctcccaaaggagccagccaagccgtgcattcttattggcccagga
acaggaattgctccattcagaagtttctggcagcagcgtctctatgacttggaaaagaaa
gggatcaaagctggtgacatgatattactgtttggctgccggcagccagatatggatcat
atctacaaagaagaagttgaagaaatgaagagaaaaggagttctgaaagaagtttttaca
gcttactccaggttacctggtcaacctaaagtctatgttcaagatattcttcaaaatgag
ttggaaaccaaagtgtgtaatatcttgcataaagaggaagggcatctgtatgtctgtgga
gatgtacgcatggccagagatgttgctcagactttgaagaggatgcttgtaaaaaacctg
gaccacacagagaagcaggcagaagagtatttcttccagctaaagagccaaaagcgatac
catgaagacatatttggggctgtgttcccacatgaagttaaaagaacataa

DBGET integrated database retrieval system