KEGG   Mycoplasma genitalium M6282: CM3_01380Help
Entry
CM3_01380         CDS       T02210                                 

Definition
(GenBank) HMW2 cytadherence accessory protein
Organism
mgq  Mycoplasma genitalium M6282
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFQ03538
LinkDB All DBs
Position
258701..264118
Genome map
AA seq 1805 aa AA seqDB search
MKPFDKKPSLQPIYDIGFDDGYLQSEYEKNRSKTDVDKIENQLLKEIKSLEDELKNLKGL
KNQAEDNPELDKKINHLEVDLNRLVNEYKNFQFQKNHMVDKVSELDNLTRFYKNELTRLQ
QENADFLNSKYANLANFQANYHNKLNDFHRLIENQNQTINRLNQKINGNQNLIDNNVALL
QNPNITVEKKNYLLNVIDQLYNELDQLENQKRLLSIEYENTYRELVSADNELQNVYENID
QNQIQFKHQYQTYRDELSQLERKIQLTKQELVDKESALRVKIDDADFYINARLAELDDVA
KQLSFQDGITKQNAQHVEDKLVALNKEKDRLNTQKEAFFNLRQSALIDINKLQQENELFA
KHLEHQQNEFEQKQSDSLLKLETEYKALQHKINEFKNESATKSEELLNQERELFEKRREI
DTLLTQASLEYEHQRESSQLLKDKQNEVKQHFQNLEYAKKELDKERNLLDQQKKVDSEAI
FQLKEKVAQERKELEELYLVKKQKQDQKENELLFFEKQLKQHQADFENELEAKQQELFEA
KHALERSFIKLEDKEKDLNTKAQQIANEFSQLKTDKSKSADFELMLQNEYENLQQEKQKL
FQERTYFERNAAVLSNRLQQKREELLQQKETLDQLTKSFEQERLINQREHKELVASVEKQ
KEILGKKLQDFSQTSLNASKNLAEREMAIKFKEKEIEATEKQLLNDVNNAEVIQADLAQL
NQSLNQERSELQNAKQRIADFHNDSLKKLNEYELSLQKRLQELQTLEANQKQHSYQNQAY
FEGELDKLNREKQAFLNLRKKQTMEVDAIKQRLSDKHQALNMQQAELDRKTHELNNAFLN
HDADQKSLQDQLATVKETQKLIDLERSALLEKQREFAENVAGFKRHWSNKTSQLQKVYEL
TKKQESEQTQKETELKIAFSDLQKDYQVFELQKDQEFRQIEAKQRELDKLAEKNNQVKLE
LDNRFQALQNQKQDTVQAQLELEREQHQLNLEQTAFNQANESLLKQREQLTKKIQAFHYE
LKKRNQFLALKGKRLFAKEQDQQRKDQEINWRFKQFEKEYTDFDEAKKRELEELEKIRRS
LSQSNVELERKREKLATDFTNLNKVQHNTQINRDQLNSQIRQFLLERKNFQRFSNEANAK
KAFLIKRLRSFASNLKLQKEALAIQKLEFDKRDEQQKKELQQATLQLEQFKFEKQNFDIE
KQRQLVAIKTQCEKLSDEKKALNQKLVELKNLSQTYLANKNKAEYSQQQLQQKYTNLLDL
KENLERTKDQLDKKHRSIFARLTKFANDLRFEKKQLLKAQRIVDDKNRLLKENERNLHFL
SNETERKRAVLEDQISYFEKQRKQATDAILASHKEVKKKEGELQKLLVELETRKTKLNND
FAKFSRQREEFENQRLKLLELQKTLQTQTNSNNFKTKAIQEIENSYKRGMEELNFQKKEF
DKNKSRLYEYFRKMRDEIERKESQVKLVLKETQRKANLLEAQANKLNIEKNTIDFKEKEL
KAFKDKVDQDIDSTNKQRKELNELLNENKLLQQSLIERERAINSKDSLLNKKIETIKRQL
HDKEMRVLRLVDRMKLAEQKYQTEINRLRTQTFDSEKQDIKNFFPPLFKINGNDMAFPYL
YPWLYPQQKQDDNTLQIRQLFEQQLQFMQQRYENELNELRRQRNLLEKKLDQIQLESQLN
NKQSEFSKVESMMEKLLEKTESRLNDFDQKINYLTKKVNQHNTYQPSSYQPTPSYQDSDK
QQLLFRIQELEKQNLFQQQFQPAPAVVQQPTSFAAPNITKQQQIAQLNAEINNIKRLIAQ
KAASK
NT seq 5418 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatttgataaaaaaccttcgctgcaaccaatttatgacattggttttgatgat
ggttatctccaaagtgagtatgaaaaaaatcgttctaaaaccgatgttgataagatcgaa
aaccagcttttaaaagagattaaaagcctggaagatgaacttaaaaaccttaagggcttg
aagaatcaagcagaagataatcctgaacttgataaaaagattaaccacttggaagttgat
ctaaaccgtttggttaatgaatataaaaacttccagttccaaaagaaccacatggttgat
aaggttagtgaacttgataacttaacccgtttttataagaatgaactaacccgcttacaa
caagaaaacgctgattttctcaactccaagtatgctaatttagctaacttccaagctaac
taccacaataaactaaatgattttcaccgcttaatagaaaatcaaaaccaaaccattaac
cgcttaaaccaaaagattaatggtaaccaaaatctgattgataataacgttgctttactg
caaaaccccaacatcacagttgaaaaaaagaactacttactaaatgttattgatcaactt
tacaatgagcttgatcaacttgagaatcaaaaaagattattaagtattgagtatgaaaat
acctatagagagttagttagtgcagataatgaactgcaaaatgtttatgaaaacatcgat
caaaatcagatccagtttaaacaccaataccaaacttatagagatgagttaagtcaactt
gagcgcaagatccagctcaccaaacaagagttagttgataaagaatcagcactaagagta
aagatagatgatgctgatttttacattaatgcccgtttagctgaacttgatgatgtagct
aaacaacttagctttcaagatggtattaccaagcaaaatgctcaacatgttgaggataag
ttagttgctttaaacaaagaaaaagaccgtttaaatacccaaaaagaggccttttttaac
ttaagacaatctgctttaattgatatcaataaactccagcaggaaaatgaactgtttgct
aagcacttagaacaccagcaaaatgagtttgaacaaaaacagtctgatagcctcttaaag
cttgaaactgaatataaggctttacaacacaagattaatgaatttaaaaatgaaagtgcc
actaagagcgaggaacttttaaaccaagaacgggaactatttgaaaaacgcagggaaatt
gacacgcttttaacccaagcatctttggaatatgaacaccaacgtgagtcaagtcaacta
ctcaaagataagcagaatgaagtaaaacaacacttccaaaacttagagtatgctaaaaag
gagctagacaaagaaagaaacctcttagatcaacaaaaaaaagttgatagtgaagcaatc
tttcaactcaaagaaaaggttgctcaagaacgtaaggagcttgaagaactataccttgtt
aaaaaacaaaaacaagatcagaaggaaaatgaactgttgttttttgaaaagcagttaaaa
caacaccaagcagattttgaaaatgaattggaagctaaacaacaggagttgtttgaagct
aaacatgcattggaacgttcctttatcaaacttgaagataaagaaaaagatcttaacact
aaagcacaacagattgccaatgagttttcccaactaaaaactgataagtcaaagagtgct
gattttgaactaatgttgcaaaatgagtatgaaaacttgcaacaagaaaaacaaaagtta
ttccaagaacgtacttactttgaaaggaatgctgcggttttatcaaaccggttacaacaa
aaacgtgaggagttattacaacaaaaagaaacgcttgatcagcttacaaaaagctttgag
caagaacggttaatcaaccaaagggaacacaaggagttggttgcatcagttgaaaaacaa
aaggagatattgggcaaaaaactccaagatttttcccaaacttcactgaacgcttctaaa
aatttagctgaacgggagatggcaatcaagtttaaagaaaaggagatagaagcaactgaa
aagcaactgttaaatgatgttaataatgctgaagttatccaagcagacttagcacaactc
aaccaatcacttaaccaagaacgcagtgaattgcaaaacgccaaacaaaggattgctgat
tttcacaatgattcactaaaaaaactcaatgagtatgaacttagcttacaaaaacggttg
caagaattacaaacccttgaggctaaccaaaaacaacattcgtatcaaaatcaagcttac
tttgaaggtgaacttgataaacttaacagagaaaaacaagcttttttgaacttacgtaag
aaacaaactatggaggttgatgctattaaacaaaggttgagtgataaacatcaagcttta
aatatgcaacaagcagagctagatagaaaaacccatgagttaaataatgcttttttaaac
catgatgcggatcaaaagagtctacaggaccaactagcaactgttaaagagacccaaaaa
ctaattgatttagaacgtagtgcactgcttgaaaagcaacgtgagtttgctgaaaatgtt
gctggttttaagcgccattggtctaataaaactagtcaactccaaaaggtttatgaactg
accaaaaaacaggaaagtgagcaaacccaaaaggaaacagaactaaagattgcttttagt
gatctacaaaaagactatcaggtttttgaactccaaaaggaccaagaatttagacaaatt
gaagctaagcaacgtgaacttgacaagttagctgaaaaaaataatcaggtcaaactagaa
cttgataacaggtttcaagcgctgcaaaaccaaaagcaagacacagtacaagctcagcta
gaactggaacgtgaacaacaccagttaaaccttgagcaaactgctttcaaccaagctaat
gaatcacttttaaaacaacgtgaacaactcaccaaaaagatccaagctttccactatgag
ttgaaaaagcgtaaccaattcttagctttaaaagggaaaaggttgtttgcaaaagaacaa
gatcaacaacgcaaagatcaggagatcaactgacgctttaaacagtttgaaaaggaatat
actgattttgatgaagctaagaaaagggaacttgaagaacttgaaaagatcagaagaagt
ttaagtcaaagtaacgttgaattagagagaaaaagagaaaaactggctactgatttcact
aatttaaataaggttcaacacaacacccaaattaaccgtgatcaacttaacagtcagatc
agacagttcttattagaacgcaaaaacttccaacgctttagtaatgaagctaatgctaaa
aaagcctttttaattaagcgcttaagaagctttgcatccaatctaaaactccaaaaagaa
gcgttagcaatccaaaaactagagtttgataagcgtgatgaacaacagaaaaaagagtta
cagcaagctactttacaactagaacagttcaagtttgaaaagcaaaactttgacattgaa
aaacaacgccaactagttgctattaaaactcagtgtgaaaaacttagtgatgaaaaaaag
gcactaaaccaaaagctagttgaactaaaaaacttatcccaaacctatcttgctaataag
aataaggctgaatactcccagcaacaactccaacagaaatacaccaatttacttgatctg
aaggaaaacttagagagaaccaaagatcaattagataaaaaacatcgttctatcttcgct
agattaactaagtttgcaaatgacttacgttttgaaaaaaagcaactgttaaaagcacag
cgcatagttgatgataaaaaccgtcttttgaaagaaaatgaacgtaacctccatttcctt
tccaatgaaacagaacgaaaacgagcagttctcgaagatcaaatttcttactttgaaaaa
caacgtaaacaagctactgatgcgatcctagcatcacataaagaagttaaaaagaaggaa
ggtgaactgcaaaagttactggttgaattagaaacaagaaaaaccaaactcaacaatgat
tttgcaaaattctcaagacaacgtgaagagtttgaaaaccaacgcttaaagctcttggaa
ctgcaaaaaaccctgcaaacccaaactaattccaacaactttaaaaccaaagcaatccaa
gagattgaaaacagttataaaagggggatggaagaacttaacttccaaaagaaggagttt
gataagaataaatcacgcttatatgaatactttagaaagatgcgtgatgagattgaaaga
aaggaaagtcaggttaagttagttttaaaagagacccaaaggaaagccaacctcttagaa
gcacaagccaacaaacttaacattgaaaaaaacactattgactttaaagaaaaagagtta
aaagcctttaaagataaggttgatcaagacattgattcaaccaataaacaacgcaaggag
ttaaatgagcttttaaatgaaaacaagttattacaacaatcactaatcgaaagagaaagg
gctattaattccaaagattcacttctaaataagaagatagaaacgattaaacgccaactc
catgataaggagatgcgggtgttgcgcttggttgatagaatgaaattagcagaacagaaa
taccaaacagaaatcaaccgcttaagaacccaaactttcgattctgaaaaacaagacatt
aaaaacttcttcccaccgttatttaaaattaacggtaatgatatggcctttccttactta
tacccctgactatatcctcaacaaaagcaagatgataacactctgcaaattcgtcagctt
tttgaacagcagctgcagttcatgcaacaacgctatgaaaatgagttaaatgaattgcgt
agacaacgtaatttacttgagaaaaaacttgatcaaatccaactagaatcccagcttaac
aataagcaaagtgagtttagtaaggtggaatcaatgatggaaaaactacttgaaaaaact
gagagtaggttaaatgattttgatcagaaaattaactatctcaccaagaaagttaaccaa
cacaacacctatcaaccaagttcctatcaaccaactccttcttatcaagacagtgataaa
caacagttgttatttagaatccaagaactggaaaaacaaaacttattccaacaacaattt
caacctgcaccagctgttgtccaacaacctactagttttgcagcccctaacatcaccaaa
caacagcaaattgcccaacttaatgctgaaattaacaacattaaaaggttgattgcccaa
aaagcagcaagtaaataa

DBGET integrated database retrieval system