KEGG   Pyricularia oryzae 70-15: MGG_00168Help
Entry
MGG_00168         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mgr  Pyricularia oryzae 70-15
Pathway
mgr00020  Citrate cycle (TCA cycle)
mgr00190  Oxidative phosphorylation
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
mgr01130  Biosynthesis of antibiotics
mgr01200  Carbon metabolism
Module
mgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mgr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MGG_00168
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MGG_00168
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MGG_00168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 2674646
NCBI-ProteinID: XP_003718957
UniProt: G4NE44
LinkDB All DBs
Position
5
AA seq 646 aa AA seqDB search
MAPTMAMRAARNVFRTTTARQIRPFSSTRPAARIFGNAPLRAKEASPHVSGKYPVIDHEY
DAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWH
MYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGKIYQRAFGGQSQKYGK
GGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAMDLIMQDGECVGVVAYNQEDG
TLHRFFAKNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYG
AGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKD
HIYLQLSHLPAEVLAERLPGISETAAIFSGVDVTKQPIPVLPTVHYNMGGIPTRYTGEVI
TVDESGKDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFSPGQKH
TPAAADAGAESIEVLDQVRTADGPKSTAEVRLAMQKAMQTDVSVFRTQESLDEGVRKVNE
VDQMFSQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVSAAARKESRGAHAREDYPDRD
DDNWMKHTLSYQKKPHGKVELSYRGVIGHTLDEKECAAVPPFKRVY
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacaatggcgatgagagctgcacggaatgtgttccgcacaactactgctagg
cagatcaggccgttctcgtcgacccgacctgcggcaagaatattcggcaatgcgcctctg
agggcaaaggaggcatctcctcatgtcagcggcaaatacccggtcattgaccacgagtac
gatgcgatcgttgtcggtgccggtggtgccggtctacgcgccgccttcggtctggccgag
gccggcttcaacactgcctgtatatcgaagcttttccctaccaggagtcacactgtcgcc
gcacagggtggtatcaacgctgcccttggtaacatgcacgaagacgactggaggtggcac
atgtacgataccgtcaagggctccgactggcttggagaccaggatgctattcactacatg
acccgcgaggctcccgcatcgattatcgagcttgagaactacggttgcccgttctcgcgt
accgaggatggcaagatttaccagcgcgctttcggtggtcagtcgcagaagtatggcaag
ggcggacaggcataccgctgctgtgctgctgccgacaggacaggacacgcccttctgcac
accctttacggacagtctctgcgccacaacacgaactacttcattgaatacttcgccatg
gacctgatcatgcaagacggcgagtgtgtcggtgttgttgcgtacaaccaggaggacggc
actctgcacaggttcttcgccaagaacaccgttcttgccactggtggatacggtcgtgca
tacttcagctgcacatcggcgcacacttgcactggtgacggtatggccatggttgcccgt
gccggcctgcccaaccaggatctggagttcgttcagttccaccctaccggtatttacgga
gctggctgcctgattactgagggctctcgtggtgagggtggttaccttctcaactcagag
ggtgagcgcttcatggagcgttatgcccctactgctaaggatctggcctctcgtgacgtc
gtctctcgttccatgaccatggagatccgcgagggacgtggtgttggccctgagaaggac
cacatctacctgcagctcagccatcttcctgccgaggttctggcggagcgtctgcccggt
atctctgagactgccgccatcttctctggtgtggatgtcaccaagcagcccatccccgtc
ctgccgaccgtccactacaacatgggtggtatccccacgaggtacactggtgaggttatc
actgtcgacgagagcggcaaggacaaggtcgtccccggtcttttcgcttgtggtgaggct
gcctgtgtgtctgtgcacggtgccaaccgtctgggtgccaactctctgcttgacttggtc
gtcttcggtcgtgctgtctcgcacaccatccgtgacaacttcagccccggccagaagcac
acccccgccgccgccgacgctggtgccgagtcgatcgaggttctcgatcaggtccgcact
gctgacggccccaagagcaccgccgaggtcaggctggcgatgcagaaggccatgcagacc
gatgtcagcgtcttccgtacccaggagtcgcttgatgagggtgtccgcaaggtgaacgag
gttgaccagatgttcagccaggtcggcaccaaggacaggagcatgatctggaactctgac
ctggttgagacccttgagctgaggaatctgttgacttgcgctactcaaaccgccgtctcg
gctgccgcaaggaaggagtcgcgtggtgcccacgcccgtgaggactaccccgaccgtgac
gatgacaactggatgaagcacactcttagttaccagaagaagccgcatggcaaggttgag
ctttcataccgtggagtcattggtcacaccctagacgagaaggagtgcgcggcggtcccg
cctttcaagcgtgtatactaa

DBGET integrated database retrieval system