KEGG   Magnaporthe oryzae: MGG_02378Help
Entry
MGG_02378         CDS       T01027                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00250  Alanine, aspartate and glutamate metabolism
mgr00410  beta-Alanine metabolism
mgr00430  Taurine and hypotaurine metabolism
mgr00650  Butanoate metabolism
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
Module
mgr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MGG_02378
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MGG_02378
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MGG_02378
   00430 Taurine and hypotaurine metabolism
    MGG_02378
Enzymes [BR:mgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MGG_02378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 2681475
NCBI-ProteinID: XP_003709153
UniProt: G4MR06
LinkDB All DBs
Position
1
AA seq 517 aa AA seqDB search
MVHLTSIPSHEEADDKIVSGVKKVHLQLANDEDKFTTSVYGSRFAIDDLPKHEMAENEMP
KEVAYRMIKDELSLDGNPMLNLASFVTTYMEEEAEKLMADSFSKNFIDYEEYPQSADIQN
RCVAMIGRLFNAPVGASEGVGAVGTSCVGSSEAIMLAVLAMKKRWKNKRLAEGKSVDKPN
LIMSSAVQVCWEKATRYFEVEEKLVYCSPDRYVIDPKETVDLVDENTIGICVILGTTYTG
EYEDVRAVNDLLNERGLETPIHVDAASGGFVAPFVVPDLEWDFRCDRVVSINVSGHKYGL
VYPGVGWVVWRSAEFLPQELVFNINYLGADQASFTLNFSKGASQVIGQYYQLIRLGKHGY
RAIMSNLTRTADYLSDSLEALGFGIMSKKSGEGLPLVAFRLTPDEDRIYDEFAIAHQLRV
RGWVVPAYTMAPHTENLKMLRVVVREDFTRNRCDALIADVKLSLELLNQMDKKELERHQD
VIHKHGTHSGKASHNHPRFRKEKHSLQGKHGKTHAVC
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggttcacctcacctcaattccctcccacgaggaggccgatgacaaaatcgtcagtggt
gtcaagaaagtccatctccagcttgccaatgacgaggacaagtttactacgtcggtctac
ggctctcgcttcgccatcgatgacctacccaagcacgagatggcggaaaacgagatgccc
aaggaggttgcctaccgcatgatcaaggacgagctcagcttggacggtaacccgatgctc
aacctagcttcatttgtgacaacctacatggaagaagaagcagagaagctcatggccgac
tctttctccaagaacttcattgactacgaagagtacccccagtcggccgacatccagaat
agatgtgtcgccatgatcgggcgcctgtttaatgctcccgtcggagcgagcgagggggtt
ggcgcggtcgggaccagctgtgtgggaagctcagaggccatcatgcttgccgtcttggcc
atgaagaagcgatggaagaacaagcgcctggccgagggcaagtccgtcgacaagccgaac
ctgatcatgagcagtgccgtccaagtgtgctgggagaaggccactcgctactttgaggtc
gaggagaagctcgtttactgctctcccgaccgctacgtcatcgaccccaaggagacggtc
gacctggttgatgaaaacaccattggtatttgcgtcattctcggcactacttacactggc
gagtacgaggatgttcgcgccgtgaatgaccttctaaatgagcgcggactcgagactccg
atccacgtcgatgccgccagcggtggcttcgtcgccccctttgttgttccagacttggaa
tgggactttcgctgcgaccgcgtcgtgtccatcaacgtctcgggccataagtacggcctt
gtctatcccggtgtgggctgggtggtatggcgctcggccgagttcctgccccaggagctc
gtcttcaacatcaactacctcggcgccgaccaggcgtccttcaccctcaacttcagcaag
ggtgcctcgcaagtcattgggcagtactaccagctcatccgtctgggcaagcacggctac
cgcgccatcatgtccaacttgacccgcacggccgattacctctccgacagcctcgaagcg
ctgggtttcggcatcatgtccaagaagtcgggagagggtctgccgctcgtggctttcagg
ttaaccccagacgaggacagaatctacgacgagtttgcgattgcgcaccagctcagggtc
aggggctgggtcgttcccgcgtatacgatggcgccgcacaccgagaacctcaagatgctg
cgcgttgtggtcagggaggactttacgcgcaaccggtgcgacgccttgatcgccgacgtg
aagctgagcttggagctgctcaaccagatggacaagaaggagctcgagaggcaccaggat
gtcatccacaagcatggaacgcacagcggcaaggcatcgcacaaccatccgaggttcagg
aaagaaaaacattcgctgcaaggaaagcacggcaagacacatgcggtgtgctaa

DBGET integrated database retrieval system