KEGG   Magnaporthe oryzae: MGG_02625Help
Entry
MGG_02625         CDS       T01027                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MGG_02625
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MGG_02625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 2682824
NCBI-ProteinID: XP_003721165
UniProt: G4NJK6
LinkDB All DBs
Position
7
AA seq 158 aa AA seqDB search
MVKAVAVLRPDPNATVQVSGHVIFEQESESSPTKVTWDFKGCDANAKRAFHIHTFGDNTN
GCTSAGPHFNPHNKEHGAPEDENRHVGDLGNFDTDGQGNASGSKEDKFIKLIGPESVVGR
TLVVHAGTDDLGRGGHAESKKTGNAGGRPACGVIGISS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagctgtcgccgtcctccgtcccgaccccaacgcgactgtccaggtctccggg
cacgtcatctttgagcaggaaagcgagagctcccccaccaaggtgacctgggacttcaag
ggctgcgacgccaacgccaagcgtgccttccacatccacacctttggtgacaacactaac
ggttgcacttcggctggccctcacttcaacccccataacaaggagcacggcgcccccgaa
gatgagaaccgccacgttggtgaccttggcaacttcgacactgacgggcagggcaacgcc
agtggatccaaggaggacaagttcatcaaactgatcggccccgagagcgtcgtcggccgt
actttggttgtccacgccggcactgacgatctcggccgtggtggccacgccgagtccaag
aagactggcaacgccggcgggcgtcccgcctgtggtgtcatcggcatctcgtcttaa

DBGET integrated database retrieval system