KEGG   Magnaporthe oryzae: MGG_05367Help
Entry
MGG_05367         CDS       T01027                                 

Definition
(RefSeq) glutathione transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MGG_05367
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mgr02000]
    MGG_05367
Enzymes [BR:mgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MGG_05367
Transporters [BR:mgr02000]
 Other Transporters
  Pores ion channels [TC:1]
   MGG_05367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_2 GST_C_5 GST_C
Motif
Other DBs
NCBI-GeneID: 2675856
NCBI-ProteinID: XP_003710212
UniProt: G4MKW5
LinkDB All DBs
Position
1
AA seq 284 aa AA seqDB search
MTNVDTSILDHATGRAAELAKAHSAEQPLKLYAGWFCPFVQRSWIVLEEKRIPYQYIEIN
PYHKSPDFLALNPRGLVPTLAVPHATTSTGDKQQTKPLYESTIIDEYLDEAYADQSAHGP
PLLPGDPYQRARCRIWIEHCGKIVAGFYKVLQHTPGKSTYGAEEAREAFCGPIKTLVEHM
AVDGGPWFLGAEFSLVDVTLAPFARRLWLLDHYKPNWGGMPDGDDDDKRIAQRWKVWVDA
CLARESVVATSSDDAAYIDVYRRYAEDRTNSKVAQATRTGDKLP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgtggacaccagcatcctcgaccacgcgaccggccgcgcagccgagctcgcc
aaggcccactcggccgagcaaccactcaagctctacgcgggctggttctgcccgtttgtg
cagcggtcgtggatcgtgctcgaggagaagcgcatcccgtatcagtacatcgagatcaac
ccgtaccacaagtcgcccgacttcctagccctcaacccgcgcgggctcgtcccgaccctg
gccgtgcctcatgccaccaccagcacaggcgacaagcagcagaccaagcccctgtacgag
agcaccatcatcgacgagtacctggacgaggcctacgccgaccagtccgcccacggcccg
cccctcctgcccggtgacccttaccagcgcgcgcgctgccgcatctggatcgaacactgc
ggcaagatcgtggccggcttctacaaggtcctgcagcacacgcccggcaagtcgacctac
ggcgccgaggaggcgcgcgaggcgttttgcgggcccatcaagacgttggtggagcacatg
gccgtcgacggcgggccgtggttcctcggcgccgagtttagcctcgtcgacgtgacgctg
gcgccgtttgcgcgcaggctgtggctgctggaccactacaagccaaactggggcggaatg
cccgacggcgacgacgacgacaagaggatcgcgcagaggtggaaggtctgggtcgacgct
tgcctggctagggagagcgtcgtcgcgacgtcgagtgacgacgcggcttatattgatgtt
tatcgccgctatgcggaggataggacgaactcaaaggttgcgcaggcgactcggacgggg
gataagctgccgtga

DBGET integrated database retrieval system