KEGG   Pyricularia oryzae 70-15: MGG_06421Help
Entry
MGG_06421         CDS       T01027                                 

Definition
(RefSeq) CAMKK/META protein kinase
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
mgr  Pyricularia oryzae 70-15
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgr01001]
    MGG_06421
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     MGG_06421
Protein kinases [BR:mgr01001]
 Serine/threonine kinases: Other
  CAMKK family
   MGG_06421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 2684576
NCBI-ProteinID: XP_003717147
UniProt: G4N7H1
LinkDB All DBs
Position
4
AA seq 651 aa AA seqDB search
METPLTPPPQPSRSSCSSPALVPPPSPGIQIDLATGEVTRKVPCDPRPAFPANLSAPAVP
TTYQSPIRQHRRTPSQHREVKETLNARSEYTNDDEDGRSHQTVNQYTIKEEIGRGSYGAV
HLATDQYGNEYAVKEFSKARLRKRAQSNILKGPREPGQFPRMFQSAIGSRLNEYRTAEAK
DALYLIREEIAIMKKLNHPNLVQLIEVLDDPEEDSLWMVLEMCKKGVIMKVGLDQAAEPY
GEEQCRHWFRDLILGIEYLHAQGIVHRDIKPDNLLLTEDDILKVVDFGVSEMFEKPNEMQ
TAKSAGSPAFLPPELCVARHGNVSGAAADIWSMGASLYCMRYGRIPFDRSTPLEIYEAIT
TEPLKLPADENPDFVDLLSRIMQKDPGQRIRMEELREHPWVTRKGTDFLLSKEDNCSVIL
EPPNGLEVNHAFTRRMSHLLCVMKAISRFKSLLYSRSMPGTPRRALETRNRDAESHAAEG
KPKLSLSPSANDLASTTEASPNLEQAAALVAERHKFFHAGRALAGTAKGQAHDPTDVEPL
FLGIGTGGRDDFAGNDPPAEEVSESPVAVDFNVYDSAYKSEVDRIKEETSERPPTMFLTQ
LVDKRELFRSDSDIVSTAESSLDSNVQGQGSGNLGSSSEEKFSDLTIEDAK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgcctctcacgccaccaccacaaccatccaggagcagctgttcgtctcctgcc
ctagtccccccgccctcgcctggcattcagatcgatttggctactggcgaggtaacgcgc
aaagtaccgtgcgacccccgtccagcatttcctgccaatttgtcagctcctgcggtacca
accacgtaccagagtccaattcgacagcacaggagaacgccgtcgcagcatcgcgaggtc
aaggaaactctcaatgcgcgatccgaatataccaacgacgacgaagatggccggtcacac
caaacagtcaaccagtacacgattaaggaggagatcggcaggggctcctacggcgccgtc
cacctggccaccgaccagtatggcaacgaatatgccgtcaaggagttctctaaagctcgg
ttgcggaaacgcgcgcagtcaaacatactcaaaggcccgagagagccagggcaatttcct
cgaatgttccaatccgcgattgggtcgcggttgaatgagtaccgaactgctgaagccaag
gatgccctatacttgattcgggaagaaatcgccatcatgaagaagctcaaccatccaaac
ttggttcagttgatcgaggtactcgacgatccagaggaagactcactctggatggtgctt
gagatgtgcaaaaagggcgttatcatgaaagtgggactcgaccaggctgcagagccgtat
ggtgaggaacaatgcagacactggtttcgtgacctgatattgggaattgagtacttgcat
gcgcaaggtattgttcatcgagacatcaagccagataatttgcttctcacggaggatgac
atactcaaggtcgtcgactttggcgtgtccgagatgttcgagaagcccaacgagatgcaa
acggccaaatcagctggctcaccggcttttctcccgccagaactctgtgttgccagacat
gggaacgtgtctggtgcggctgccgatatatggtcgatgggtgcctccttgtactgtatg
cggtacggcaggataccgttcgaccgttcgaccccgctcgaaatctacgaagcgatcacg
acggaaccactgaaacttccagctgacgagaatccggactttgttgatcttttgagcagg
atcatgcaaaaagaccctggccagcgtatcaggatggaggagttgagggagcatccctgg
gttaccaggaagggaacagattttctcttgagcaaagaggacaactgctccgtgattttg
gagccgccaaatggtcttgaggtcaaccacgcatttacgagaagaatgagccatttgctc
tgcgtaatgaaagcaatttcgaggttcaagagtctactgtactccaggagtatgccggga
actcctcggagagcgctggagactcggaacagagatgctgaaagtcacgcagctgagggg
aagccgaaactgtcgctgtcacctagcgccaacgatttggctagcacaacggaagcctcg
cctaacctagagcaggctgctgctcttgtggcggaacgccacaaattctttcatgctggc
cgagcgctggccggtacggccaagggacaggctcatgatcctactgacgtggaacctcta
ttccttggcatcggcaccggcggccgcgacgactttgccgggaatgatccgcccgccgaa
gaagtatcggaatcgcctgtcgcagtcgacttcaacgtttacgacagtgcatacaagagt
gaagttgatcgcatcaaggaggagaccagtgagcgtccacccacgatgtttctgacccaa
ctcgttgacaaaagggagttgtttcgcagcgacagcgacattgtctccacagctgagagt
agcttggacagcaacgttcaaggtcagggttccggtaatcttggcagttctagtgaggaa
aagttttcagacctgacgatagaggacgctaagtag

DBGET integrated database retrieval system